Vajad kellegagi rääkida?
Küsi julgelt abi LasteAbi
Logi sisse
Sulge

"effective number" - 144 õppematerjali

Järjestuste võrdlemine-otsingud andmebaasidest-BLAST-FASTA-SW-
23
doc

Järjestuste võrdlemine, otsingud andmebaasidest (BLAST, FASTA, SW).

Bioinformaatika ülesanded Järjestuste võrdlemine, otsingud andmebaasidest (BLAST, FASTA, SW). 1. BLAST programmide kasutamine tundmatu valgujärjestuse identifitseerimiseks või sarnaste valgujärjestuste leidmiseks (http://www.ncbi.nlm.nih.gov/BLAST/). Programmide kasutamisel tutvuda tutorialite ja juhenditega!!! (http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/information3.html). a. Otsida sarnaseid järjestusi antud valgujärjestusele. Valida sobiv programm vastavalt NCBI juhendile valgujärjestuse võrdlemiseks valgujärjestuste seast. Valida otsimiseks Refseq andmebaas, sooritada otsing, tulemuste formaat 500 joondamise jaoks. GTESPLLTDPSTPNFFWLAWQARDFMSKKYGQPVPDRAVSLAINSRTGRTQNHFHIHISCIRPDVRKQLDNNLAN ISSRWLPLPGGLRGHEYLARRVTESELVQRSPFMMLAEEVPEAREHMGRYGLAMVRQSDNSFVLLATQRNLLTLN RASAEEIQDHQCEILRMRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEM...

Informaatika → Bioinformaatika
41 allalaadimist
Kingdom Of Belgium Ambassador speech
1
docx

Kingdom Of Belgium Ambassador speech

Belgium Ambassador Speech Most honourable Secretary-General, President of the General Assembly, fellow delegates and lovely guests. As a founding member of the United Nations, Belgium has always approached it as the effective tool for multilateralism in order to respond to the increasing number of challenges. It is a great privilege for us to serve our country and the international community along those lines. This we do with great dedication, conviction, honour and the help of our lovely colleagues. It is a great pleasure to take part in this conference and The Kingdom of Belgium really hopes that we all will find some solutions to critical issues, which we are facing today. Thank you. The ambassador yields the floor back to the PGA.

Keeled → Inglise keel
1 allalaadimist
Aadvantages and disadvantages of being on tv
2
doc

Aadvantages and disadvantages of being on tv?

Television Advertising Pros and Cons According to a recent study by Ball State University on the media consumption habits of average Americans, despite the Internet's steady rise in popularity over the last few years, television remains the dominant medium in most U.S. households. On average, the general population spends over four and a half hours a day in front of the tube, making TV watching one of the most common modern leisure activities. Is it any wonder then that television advertising is also the most powerful form of advertising? Advertising on television allows you to show and tell a wide audience your business, product, or service. It allows you to actually demonstrate the benefits of ownership. You can show how your product or service works and how it's packaged so prospective customers will know what to look for at the point of sale. In advertising, it often takes multiple touch points to effectively influence consumers' p...

Keeled → Inglise keel
7 allalaadimist
The control of forest insects-general considerations
27
pptx

The control of forest insects: general considerations

FOREST INSECTS The control of forest insects: general considerations Important factors in the environment of forest insects Climatic conditions Food supply Natural enemies CLIMATIC CONDITIONS Temperature Insects in general have a comparatively small range of temperature within they are most active. For most species it`s between 10°C to 35°C. But there are exceptions Hymenopterous parasites, flatheaded and roundheaded bark borers. Melanophila consputa Lec. Western pine beetle Dendroctonus brevicomis Moisture Forest insects are affected directly by moisture and indirectly by its effect upon their host Light Light plays an important part in regulating the activities of various insects. Trees exposed to the full sunlight a...

Keeled → Inglise keel
13 allalaadimist
Mikrokontrollerid ja robootika homework 2
14
pdf

Mikrokontrollerid ja robootika homework 2

Question 1 Define the following ADC terms: 1. SNR – (Signal to Noise Ratio) SNR is a calculated value that represents the ratio of RMS signal to RMS noise. 2. SINAD - (signal-to-noise-and-distortion ratio) Ratio of the RMS signal amplitude to the mean value of the root-sum-square (RSS) 3. ENOB – (effective number of bits) The effective number-of-bits and relates to SINAD 4. THD - (total harmonic distortion) Ratio of the rms value of the fundamental signal to the mean value of the RSS of its harmonics. 5. SFDR - (spurious free dynamic range) Ratio of the RMS value of the signal to the RMS value of the worst spurious signal. 6. Channels - related to the inputs of the ADC can either be multiplexed or individually selected. 7. Linearity - relates to how a ADC follows a linear function. All ADCs are to a certain extend nonlinearity. 8...

Mehhatroonika → Mikrokontrollerid ja robootika
10 allalaadimist
Industry of television and video technics
10
doc

Industry of television and video technics

THE INDUSTRY OF TELEVISION AND VIDEO TECHINCS Report Table of Contents 1. Video Technics Inc.................................................................................3 1.1 About Video Technics........................................................................................... 3 1.2 Apella ­ Proven IT-Centric Technology................................................................3 1.3 Corporate Mission..................................................................................................4 2. Panasonic................................................................................................5 2.1 Introduction............................................................................................................5 2.2 Company Information............................................................................................5 2.3 Business Segments..................

Geograafia → Geograafia
9 allalaadimist
Bilingualism
1
doc

Bilingualism

Bilingualism The two most important languages on planet Earth these days are English ­ the language of international commerce and of the media ­ and Chinese, which is spoken by one of every six humans. The second tier of importance includes Spanish and Arabic and French ­ for their wide use ­ and Japanese, from Japan's economic influence. The third tier of importance covers Portuguese (for Brasil), German, and Russian. The remaining languages are essentially regional or minor. Success in business in the global economy requires fluency in one or more of the languages in Tier One or Tier Two, no matter where you live.Business operations ­ reception, customer service, sales, websites, advertising ­ that entail use of one or more languages provide access to major additional segments of the global economy. Likewise, the executive or office worker or retail clerk with multi-fluency has...

Keeled → Inglise keel
10 allalaadimist
Microcontroller homework 2
2
docx

Microcontroller homework 2

Microcontroller homework for week 04 1. SNR - Ratio of RMS signal to RMS SINAD - Ratio of the RMS signal amplitude to the mean value of the root-sum-square (RSS) ENOB - The effective number-of-bits and relates to SINAD THD - Ratio of the rms value of the fundamental signal to the mean value of the RSS of its harmonics. SFDR - Ratio of the RMS value of the signal to the RMS value of the worst spurious signal. Channels related to the inputs of the ADC can either be multiplexed or individually selected. Linearity relates to how a ADC follows a linear function. All ADCs are to a certain extend non-linearity. Temperature is measurement, which in optimal state for ADC-s, lets them function correctly. Power dissipation refers to the amount power dissipated when the ADC is operating. 2. The output code is 001111012 and the voltage of the LSB is 0,0195V ...

Masinaehitus → Mikrokontrollerid ja...
46 allalaadimist
Mother Theresa
2
doc

Mother Theresa

Mother Teresa Agnes Gonxha Bojaxhiu /agns gna bjadju/ (Albanian Gonxha for "rosebud") was born on August 26, 1910, in Skopje, now the capital of the Republic of Macedonia. Although she was born on August 26, 1910, she considered August 27, 1910, the day she was baptized, to be her "true birthday." Although some sources state that she was 10 when her father died, in an interview with her brother, the Vatican documents her age at the time as "about eight". She was the youngest of the children of a family from Shkodër, Albania, born to Kolë and Dranafile Bojaxhiu (Albanian Dranafile for "rose", nicknamed "Drone"). Her father, Kolë Bojaxhiu was involved in Albanian politics. In 1919, after a political meeting, which left Skopje out of Albania, he fell ill and died when Agnes was about eight years old. After her father's death, her mother raised her as a Roman Catholic. According to a biography by Jo...

Keeled → Inglise keel
5 allalaadimist
A short overview of veganism
18
pptx

A short overview of veganism

A short overview of veganism Veganism is both the practice of abstaining from What is the use of animal products, particularly in diet, and an associated philosophy that rejects the veganism? commodity status of animals. Eating vegan has a number of benifits that include: Why do Improving one`s health people go Helping the environment vegan? Saving the animals Our planeet is tumoil, humans are ailing in health, and animals are suffering everyday, but that can be fixed by simply going vegan, if you should be interested in contrbuting. So what? A vegan diet benifits everything and everyone on ? our planeet Simple changes in your diet and lifestyle can make a huge impact for yourself and the planeet we live on. Processed meat was rightfully demonized as ...

Keeled → Inglise keel
1 allalaadimist
UURIMISTÖÖ KOOSTAMISE JA VORMISTAMISE juhend
7
doc

UURIMISTÖÖ KOOSTAMISE JA VORMISTAMISE juhend

Kokku lepitud töörühma koosolekul 21.09.2011. UURIMISTÖÖ KOOSTAMISE JA VORMISTAMISE juhend Rapla Vesiroosi Gümnaasiumis TÖÖ STRUKTUUR · Tiitelleht · Sisukord · Sissejuhatus · Sisu (peatükid) · Kokkuvõte · Kasutatud kirjandus · Lisad Töö oodatav pikkus tiitellehe, sisukorra, kasutatud kirjanduse ja lisadeta vähemalt 12 lehekülge. Uurimistöö peab vastama enamikule alljärgnevatest nõuetest On sisult · Uudne ja aktuaalne · Objektiivne · Tõestatav, argumenteeritud · Kontrollitav · Täpne · Kriitiline · Seletav · Kirjeldav, analüüsiv · Ennustav Plagiaat (loomevargus) Plagiaati kaitsmisele ei lubata ja tööd ei arvestata. Töö ei tohi olla varastatud ega maha kirjutatud. Vormilised nõuded uurimusele · Tekst on umbisikulises tegumoes (n: töös käsitletakse) või kindla kõneviisi ainsuse kolmandas isikus (n: töö autor käsitleb...

Kirjandus → Kirjandus
12 allalaadimist
Thoughts on Air Pollution Essay
6
docx

Thoughts on Air Pollution Essay

Air pollution Every day, the average person inhales about 20,000 liters of air. Every time we breathe, we risk inhaling dangerous chemicals that have found their way into the air. Air pollution includes all contaminants found in the atmosphere. These dangerous substances can be either in the form of gases or particles. Air pollution can be found both outdoors and indoors. Pollutants can be trapped inside buildings, causing indoor pollution that lasts for a long time. The sources of air pollution are both natural and human-based. As one might expect, humans have been producing increasing amounts of pollution as time has progressed, and they now account for the majority of pollutants released into the air. Air pollution has been a problem throughout history. Even in Ancient Romepeople complained about smoke put into the atmosphere. The effects of air pollution are diverse and numerous. Air...

Keeled → Inglise keel
3 allalaadimist
Raketised
8
pdf

Raketised

Seinaraketis MAXIMO seinaraketis Võimaldab kiiret rakestamist ning korrapärast tõmbide paigutust MAXIMO seinaraketisega on saavutatav väga hea kvaliteediga korrapärane betoonipind. Tänu uuele tõmbisüsteemile ei ole vaja rakestamisel kasutada plasttorusid ning töö toimub vaid ühel pool raketist. See vähendab kulusid ning säästab aega ja ressursse. Lisaks paneel-seinaraketise eelistele nagu paindlikkus ja kiire paigaldamine avab MAXIMO uusi võimalusi betoonipinna vormimises läbi kilpide paigutamise. Eelised • Kiirem Spetsiaalselt arendatud MX-tie tehnoloogia võimaldab töölisel töötada ainult ühel pool raketist ning ka traditsioonilisi koonililisi plastläbiviike ei ole enam tarvis. • Tsentraalselt paigutatud tõmbiavad Tsentraalselt paigutatud tõmbiavade süsteemi puhul peavad kõik avad täidetud olema. See väldib vigu paigaldamise ajal. Samuti ei ole tarvis tühje tõmbiavasid plastkorkidega katta...

Ehitus → Ehitus
25 allalaadimist
The economics of fare trade
12
pptx

The economics of fare trade

THE ECONOMICS OF FARE TRADE RALUCA DRAHUSANU DANIELE GIOVANNUCCI NATHAN NUNN Summarised by: Tartu 2015 Outline What is fare trade? What fare trade aims to do. Requirements for certification Does fare trade work? What is fair trade? · Social movement whose stated goal is to help producers in developing countries achieve better trading conditions and to promote sustainability · Label informs consumers that the product was produced in a socially and environmentally responsible manner Fair trade aims to: · Improve the living conditions of producers in developing nations · Attempts to achieve higher prices for producers · Greater availability of financing for producers · Longer-term and more sustainable buyer-seller relationships · The creation and/or maintainance of effective producer or worker organizations · Improved social goods and c...

Keeled → Inglise keel
1 allalaadimist
ECDIS Voyage planning
31
ppt

ECDIS Voyage planning

Voyage Planning Voyage Planning The key elements of the Voyage Plan are:  Appraising all relevant information  Planning the intended voyage  Executing the plan taking account of prevailing conditions  Monitoring the vessel’s progress against the plan continuously Planning  The detailed voyage or passage plan should include the following factors: 1) the plotting of the intended route or track of the voyage or passage on appropriate scale charts: the true direction of the planned route or track should be indicated, as well as all areas of danger, existing ships' routeing and reporting systems, vessel traffic services, and any areas where marine environmental protection considerations apply; 2) the main elements to ensure safety of life at sea, safety and efficiency of navigation, and protection of the marine environment during the intended voyage or passage; such elements...

Merendus → Navigeerimine
7 allalaadimist
Homework 2 Week 4
12
docx

Homework 2 Week 4

Week 4 homework. Question 1: 1. SNR – Ratio of root mean square signal to root mean square. 2. SINAD – Ratio of the RMS signal amplitude to the mean of value of the root sum square. 3. ENOB – The effective number of bits and relates to SINAD. 4. THD – Ratio of the rms value of the fundamental signal to the mean value of RSS of its harmonics. 5. SFDR – Ratio of the RMS value of the signal to the RMS value of the worst spurious signal. 6. Channels – multiple analog signal inputs to the ADC that can be individually selected or selected through a multiplexor. 7. Linearity – Describes how an ADC conveter follows a linear function. 8. Operating temperature – A temperature at which the ADC functions optimally, usually given by the manufacturer. 9. Power dissipation – The proportion of power dissipated (through heat) when the ADC is working. Question 2: An 8 bit ADC has a reference voltage of 5V. What is the digital output code ...

Keeled → Inglise keel
4 allalaadimist
Homework 2 Solution
12
pdf

Homework 2 Solution

Question 1 (in wiki and in terminologies) 1. SNR is a calculated value that represents the ratio of root- mean-square (rms ) signal to rms noise. 2. SINAD stands for Signal-to-noise and distortion ratio. It is a measure of the quality of a signal from a communications device, often defined as: where is the average power of the signal, noise and distortion components. SINAD is usually expressed in dB. For examples to calculate the ratio of 1 kW (one kilowatt, or 1000 watts) to 1 W in decibels, use the formula 3. ENOB is the effective number-of-bits related to SINAD and the quality of a digitized signal. The 6.02 term in the divisor converts decibels (a log10) to bits (a log2) The 1.76 term comes from quantization error in an ideal ADC 4. THD - Total harmonic distortion is the ratio of the root-mean-square (rms) ...

Mehhatroonika → Mehhatroonika
3 allalaadimist
Eesti-inglise-vene laeva mehaanika terminoloogia sõnastik
26
xlsx

Eesti-inglise-vene laeva mehaanika terminoloogia sõnastik

ahtrilainete süsteem stern wave system different trim dünaamilise tõstejõuga laev dynamically supported ship erikaal specific weight Froude arv Froude number gravitatsiooniline takistus gravity-related resistance hõõrdetakistus frictional resistance hõõrdetegur coefficient of friction koosmõju interaction hürdodonaamiline rõhk hydrodynamical pressure hüdromehaanika fluid mechanics hürdrostaatiline rõhk hydrostatical pressure inertsjõud inertial force isepoleeruv värv self-polishing paint jäätakistus residual resistance jäätakistus ice resistance kaal weight käigulained shipborne waves käigulainete interferent wave systems ineraction kaikuvus prop...

Ehitus → Laevade ehitus
44 allalaadimist
Swifts A Modest Proposal
5
doc

Swifts A Modest Proposal

The use of satire in Swift's A Modest Proposal According to Oxford Advanced Learner's Dictionary satire is a way of criticizing a person, an idea or an institution in which you use humor to show their faults or weaknesses; a piece of writing in that uses that type of criticism: political/social satire (1180). Jonathan Swift, one of the ambiguous and interesting figure of the Anglo-Irish Literary Tradition, the greatest pamphleteers, and a master of satire, denotes that 'Satire is a sort of glass wherein beholders do generally discover everybody's face but their own; which is the chief reason for that kind reception it meets with in the world, and that so very few are offended with it' (Swift). The current essay attempts to analyze the use of satire in Jonathan Swift's most discussed pamphlet A Modest Proposal and the purposes of using this specific genre. The pamphlet reveals a vast number of social and reli...

Keeled → Inglise keel
3 allalaadimist
European Union
8
docx

European Union

European Union Research Compose: x X School 2009/10 What is European Union? The European Union (EU) is an economic and political partnership between 27 democratic European countries. EU population is almost a half milliard European union stands for caring and fair community. All EU members are devoted to peace, democracy, human rights respecting and working together to spread these values all the world. History The beginning of EU might consider the year 1951, when European Coal and Steel Community (ECSC) was constitute. Six countries joined with it for peace: Belgium, Netherlands, Luxembourg, Italy, France and Germany. With that move, coal and steel industry were put under one organisation, so war was almost impossible between these six country. Cooperation in different areas improved, when in 25. March 1957 Treaties of Rom , European Economic Community and European Atomic Energy Community memora...

Keeled → Inglise keel
16 allalaadimist
Project Plan
6
doc

Project Plan

Project Plan Bellacoola The Bella Coola Development Study merges community requirements for the envisioned facility and the alternative approaches to building on the Bella Coola Northern Pointe site. Consultants’ reports regarding structural considerations and tree evaluation are included for their continued application to the problem. An effort has been made to work with the full extent of space requirements currently voiced by the Western Division Management Center and the Bella Coola Village Organization. Other organizations were queried to form the basis of judgment in determining the overall need. This recognizes that as the program development progresses, tenant requirements may change, but the essential square footage and cubic limitations for a below grade structure will remain. In addition, it has been envisioned that jointly required facilities would be available for all organizations to use on a shared basis, utilizing mova...

Keeled → Inglise keel
1 allalaadimist
Introduction of SCM
40
doc

Introduction of SCM

INTRODUCTION OF SUPPLY CHAIN MANAGEMENT (SCM) A supply chain is a network of facilities and distribution options that performs the functions of procurement of materials, transformation of these materials into intermediate and finished products, and the distribution of these finished products to customers. Supply chains exist in both service and manufacturing organizations, although the complexity of the chain may vary greatly from industry to industry and firm to firm. Supply chain management is typically viewed to lie between fully vertically integrated firms, where the entire material flow is owned by a single firm and those where each channel member operates independently. Therefore coordination between the various players in the chain is key in its effective management. Cooper and Ellram [1993] compare supply chain management to a well-balanced and well-practiced relay team. Such a team...

Varia → Kategoriseerimata
3 allalaadimist
Assignment Module 3 - BEPS project Action 4
6
docx

Assignment Module 3 - BEPS project Action 4

BEPS project Action 4: Interest deductions and other financial payments Maris Leemets 10.08.2016 Peer Assignment in Module 3 The OECD with its Base Erosion and Profit Shifting (BEPS) project is working towards proposing politically feasible and multilaterally acceptable ways to minimize the corporate tax base erosion and profit shifting activities since 2013. Out of its 15 main lines of work under BEPS project (called Actions) I will concentrate on Action 4 which aims at proposing new rules for preventing the manipulation of interest expense related tax deductions of corporates. The underlying problem is that multinational groups can easily create and relocate debt in their group according to the most preferential tax treatment available which in some cases results in no or even negative corporate tax payments fr...

Keeled → Inglise keel
2 allalaadimist
Võrdlev tööõigus - inglisekeelne
6
docx

Võrdlev tööõigus - inglisekeelne

1. Social Policy aspects in EU Treaties Social and employment policy: Objectives: - The promotion of employment - Improved living and working conditions - Proper social protection - Dialogue between management and labour - The development of human resources with a view to lasting high employment and the combating of exclusion. Treaty of Rome: belief that improved working and living conditions would arise from the functioning of the common market – cooperation in the areas of employment, labour law and working conditions, vocational training, social security, occupational health and safety, and social dialogue. Improved mobility and professional opportunities of employees and introduced the equal pay for men and women – directly applicable. Single European Act: harmonisation of health and safety conditions at work; possibility for social partners at European level to negotiate collective agr...

Õigus → Tööõigus
24 allalaadimist
Stalin s Russia-political-cultural
12
pptx

Stalin's Russia: political, cultural

WHAT IS THE ROLE OF EVIDENCE IN DECIDING what separates science from pseudoscience? SCIENCE is knowledge covering general truths of the operation of general laws, especially as obtained and tested through scientific method and concerned with the physical world. PSEUDOSCIENCE is a collection of beliefs or practices mistakenly regarded as being based on scientific method. Pseudohistory is any work that claims to be history, but does not use established historiographical methods; especially one that uses disputed evidence and speculation rather than relying on the analysis of primary THE DENIAL OF HOLOCAUST real life situation of pseudohistory WHAT IS THE HOLOCAUST? the holocaust was a systematic elimination of a nation, in which approximately six million European Jews were killed during the period 1941-1945. Adolf Hitler's Nazi regime and it's collaborators were behind the genocide which took place thro...

Keeled → Inglise keel
1 allalaadimist
Key Words for Fluency L-O
2
docx

Key Words for Fluency L-O

LIMIT Ex1. 1. Searching 2. Commit 3. Lose 4. Jog 5. Ex1. 1. Set 2. Lowered 3. Exceed 4. Reached 5. Bring back 6. Blot out 7. Etched 8. Put..behind Impose 6. Test 7. Know Ex2. 1. Terrible 2. Fond 3. Hazy 4.earliest 5. Ex2. 1. Spending limits 2. Speed limit 3. Time Living 6. Distant 7. Painful 8. Short- term limit 4. Age limit 5. Credit limit 6. City limits Ex3. 1. C 2. B 3. D 4. A Ex3. 1. F 2. H 3. A 5. D 6. G 7. E 8. C METHOD LOOK Ex1. 1. Adopt 2. Work 3. Used 4. Fails 5. Devised Ex1. 1. Seen 2. Gave 3. Tell 4. Spoil 5. Like 6. 6. Recommend Has Ex2. 1. Traditional 2. infallible 3. Popular 4. Ex2. 1. B 2. D 3. E 4. F 5. G 6. A 7. C 8. H Reliable 5. Unorthodox 6. Practical 7. Effective Ex3. 1. Had 2. Took 3. ...

Keeled → Inglise keel
5 allalaadimist
Connecting Ideas Logically and Effectively
7
doc

Connecting Ideas Logically and Effectively

UNIT 6 Connecting Ideas Logically and Effectively The aim of the section is to assist you to produce an effective topic outline: a skeleton of your document. If this stage of the production process is done properly all you really need are the language control techniques to connect your ideas logically and effectively. If you have a well documented list of techniques to connect your ideas effectively the writing process is less formidable. You will want to know how to join similarities, compare and contrast certain facts, introduce the next topic, offer a supporting idea, or refer to previously presented facts. You will also need to know how to present different shades of argument to produce logically a recommendation you wish to make. This requires an ability to emphasise certain facts and 'bury' others. However, all facts need to be linked to give a logical flow. This unit will give you language practice in...

Keeled → Inglise keel
54 allalaadimist
Identiteedivargus
7
doc

Identiteedivargus

Identity theft The Estonian Information Technology College Social, Professional and Ethical Aspects of Information Technology 18.10.2016 The purpose of this paper is to raise awareness about the threats associated with Identity theft. I will talk about the different types of identity theft, the most common way they take place and what consequences they might have. I will also talk about some of the examples and point out actions everyone can take to minimize the chance of becoming a victim of an identity theft. What is Identity theft Identity theft is defined as the deliberate use of someone else's identity, usually as a method to gain a financial advantage or obtain credit and other benefits in the other person's name, and perhaps to the other person's disadvantage or loss. The person whose identity has been assumed may suffer adverse consequences if they are held responsibl...

Keeled → Inglise keel
1 allalaadimist
Decriminalizing Cannabis in Estonia
6
docx

Decriminalizing Cannabis in Estonia

Decriminalizing Cannabis in Estonia. Estonia is the leading country in Europe with the highest number of drug fatalities per capita, deaths by fentanyl are raising and current drug policy is not doing its job. According to the most recent data, Estonia's overdose mortality rate is seven times the average in the EU. This is a big concern for a country as little as Estonia, and also a reason why the decriminalizing cannabis topic has grown so popular lately. Cannabis, as a soft drug, is criminalized in Estonia and that fact leads people to go after stronger drugs because by the law they are on the same scale. The popularity of “China white” is growing in Estonia, as it is so easily accessible, but so does the mortality rate because it is very easy to overdose on fentanyl. Estonia should re- form its drug policy because stricter laws and punishments do not change society for the better and current drug polic...

Politoloogia → Expository writing
4 allalaadimist
EU internal Market-Dog case
8
docx

EU internal Market. Dog case

1. Can the PB&R company successfully claim any violation of the EU law related rights? Examination 1. Can we say that an animal (a dog) is a good? – Yes. According to Article 13 TFEU dogs do belong to a “goods” category so as it is described in CJEU case law that a good is a product which can be valued in money and which is capable of forming the subject of commercial transactions. Therefore PB&R company and its business is selling dogs, or shall I say goods not just on a local fields, but the movement of goods is linked to abroad EU countries by making a profit of it I shall conclude that it involves a “movement of goods within the EU Member States” (Articles 26 and 37). 2. Is there a restriction of trade in goods? a. Can we name an animal, or to be more exact a dog as a “good” – yes, in accordance of Article 13 TFEU: “In formulating and implementing the ...

Keeled → Inglise keel
2 allalaadimist
Monoloogid
4
docx

Monoloogid

Money in our everyday life Money plays a quite important role in our everyday life First of all, nowadays mostly everything circles around money and how much people can afford things. Secondly, every adult has to work so they could get the paycheck at the end of the month they need to pay the bills, buy food and to pay for any other expences. On the other hand, money is not the only thing in the world and money does not give you everything. You can't buy a family and friends. In conclusion, even if people work every day in order to pay for their expences, money is not the only thing in the world that makes people happy and satisfied with their life Advertising on TV Advertising on TV is a very popular way that companies use to advertise their products. First of all, advertisements on TV are called commercials and to get air time on Tv is very expencive and not every company can offord it. Secondly, TV commercials mingt be the easyest wa...

Keeled → Inglise keel
40 allalaadimist
MRSA
10
doc

MRSA

MRSA: Understand your risk and how to prevent infection James Steckelberg, M.D. MRSA - or methicillin-resistant Staphylococcus aureus - has been a problem in hospital and health care settings for years. But this highly drug-resistant bacterium has gained attention in recent years for its role in several deaths among otherwise healthy school-age athletes. Are MRSA infections on the rise? What are the real risks of MRSA infection for you or your child? And what can you do to protect against MRSA infection? James Steckelberg, M.D., an infectious disease specialist at Mayo Clinic, Rochester, Minn., answers these and other common questions about MRSA. What is MRSA, and why is it sometimes referred to as a "superbug"? · MRSA in hospitals. MRSA infection is caused by Staphylococcus aureus bacteria - often called "staph." Many years ago, a strain of staph emerged in hospitals that was resistant to the broad-spectrum ant...

Meditsiin → Nakkushaigused
36 allalaadimist
Infectious bovine keratoconjunctivitis 2019
9
docx

Infectious bovine keratoconjunctivitis 2019

Infectious bovine keratoconjunctivitis Kristjan Rannaäär Veterinary medicine, 2. year, 2. group Abstract Infectious bovine keratoconjunctivitis (IBK) is a highly contagious ocular disease and big problem in cattle farms worldwide. It is the most common ocular disease of cattle caused by bacteria Moraxella bovis. This study focuses on IBK despite having low mortality rate and complete recovery, it causes significant loss of productivity in the herds affected due to the costs of treatment and considerable impact on afflicted animals, including blindness. This research is focused on the details, such as risk factors, pathogenesis, etiology, clinical signs prevention, transmission, and treatment, which animal handlers should be aware of to minimize the harm caused by IBK. Vaccination does not ensure lifelong immunity and not prevent a primary and reinfection of the cattle. Therefore, it is necessary to keep the cattle in a healthy...

Inimeseõpetus → Inimese anatoomia
1 allalaadimist
INVESTBULGARIA AGENCY
23
pptx

INVESTBULGARIA AGENCY

INVESTBULGARIA AGENCY WHO ARE WE InvestBulgaria Agency (IBA) is a Government institution providing information, contacts and project management support to potential investors. IBA services: Macroeconomic data on Bulgaria Data on operational costs Regional information Personalized administrative servicing Legal advice Liaison with central and local governments Liaison with branch chambers and NGOs www.investbg.government.bg GENERAL INFORMATION Official name: Republic of Bulgaria Area: 110 994 sq.m. Population: 7.4 million Capital: Sofia Time zone: EET (UTC+2) Official language: Bulgarian Currency: Lev (BGN) Fixed exchange rate: 1 = BGN 1.95583 Type of government: Parliamentary Member of: EU, NAT...

Keeled → Inglise keel
1 allalaadimist
Stonehenge
4
doc

Stonehenge

Stonehenge Stonehenge is a prehistoric monument located in the English county of Wiltshire, about 3.2 kilometres (2.0 mi) west of Amesbury and 13 kilometres (8.1 mi) north of Salisbury. One of the most famous prehistoric sites in the world, Stonehenge is composed of earthworks surrounding a circular setting of large standing stones. Archaeologists had believed that the iconic stone monument was erected around 2500 BC, as described in the chronology below. However one recent theory has suggested that the first stones were not erected until 2400-2200 BC,[1] whilst another suggests that bluestones may have been erected at the site as early as 3000 BC (see phase 1 below). The surrounding circular earth bank and ditch, which constitute the earliest phase of the monument, have been dated to about 3100 BC. The site and its surroundings were added to the UNESCO's list of World Heritage Sites in 1986 in a co-lis...

Keeled → Inglise keel
5 allalaadimist
Guidelines for writing tasks
4
doc

Guidelines for writing tasks

Writing tasks Formal letters 120 words I Tegemist on ametliku kirjastiiliga ja lühivormid (don't, can't, I'm etc.)on keelatud! Kaotate kohe punkte II * Dear Mr. Smith (ja eesnime ei tohi kirjutada!!!) * Kui teame nime, siis lõpp Yours sincerely ja allkiri ja ülesandes antud nimi * Kui nime pole öeldud, siis Dear Sir or Madam * Kui nime ei tea, siis lõpus Yours faithfully ja allkiri ja ülesandes antud nimi Enda nime ei tohi mitte mingil juhul kirjutada!!!!! Te olete kas Jürid või Marid, Urved või Urmased jne. Kirjade tüübid: 1) Kui peate kirjutama kirja , kus tuleb kelleltki nõu küsida, siis alustage: I am writing to ask if you could help me with... I am writing to ask for your advice... Ja lõpetage I would appreciate if you could give me your advice as soon as possible või I look forward to receiving your advice... 2) Kui peate kirjutama kirja , kus tuleb ise nõustada, siis alustage: I am writing in reply to your letter asking a...

Keeled → Inglise keel
231 allalaadimist
Trojan horse
14
docx

Trojan horse

Eriala: Informaatika Inglise keel Referaat «Trojan horse » Lektor S.Remmelg Üliõpilane A.Parts Rühm RDIR23 Kood 103373 Introduction Trojan (also - troyamn, troyamnets, troyamnsky horse Troma) - a program used by an attacker to gather information, its destruction or modification of, computer malfunction or use of its resources in the wrong purposes. According to the principle of distribution and of the Trojans is not a virus because it does not spread by self-reproduction. This Trojan is run by the user manually or automatically - the program or part of the operating system running on a victim computer (as a module or utility). For this program file (the name, icon of the program) is called the official name of masquerading as another program (such as the installation of another program), another file type, or just give us attra...

Keeled → inglise teaduskeel
2 allalaadimist
Unit 4 words
7
docx

Unit 4 words

Accessible- easy for anyone to obtain and use Admittedly- used for saying that you admit something is true, especially when this makes your main idea weaker Affordable- cheap enough for ordinary people to afford Agricultural- relating to farming Alcoves- a small area in a room that is created by building part of one wall further back than the rest of the wall Ample- enough, and often more than you need Attic- the room in a house under the roof Bedsit- a room that you rent that is used for both living and sleeping in Brick pillars- Bungalow- a house that is all on one level Caravan- BRITISH a vehicle that people can live and travel in on holiday. Caravans are usually towed (=pulled) by a car. The American word is trailer Carpenter- someone whose job is to make things from wood, or to repair things that are made of wood Cellar- a room under a building, below the level of the ground, usually used for storing things Compatible-...

Keeled → Inglise keel_baaskursus
26 allalaadimist
Artikli kokkuvõte akadeemilises inglise keeles-Understanding the Internet of Things-IoT-
10
docx

Artikli kokkuvõte akadeemilises inglise keeles „Understanding the Internet of Things (IoT)“

In the 2014 article, ,,Understanding the Internet of Things (IoT)" GSMA shares its vision of the evolution of The Internet of Things that will lead to the so-called Connected Life. The future of mobile connectivity goes beyond tablets and cars, allowing to connect virtually everything. It is assumed that there will be a significant rise of connected devices throughout the world, allowing the growth of new services, transforming the way people work and live. The lack of human interaction will probably cause the emergence of new business models and promote the delivery of services across diverse socio-economic sectors. A research by Machina Research predicts that the Internet of Things is likely to boost the economy by an enormous amount up to US$ 4.5 trillion yearly. The needs of variable industries are already met by the use of Machine to Machine (M2M) solutions using wireless networks. Being a relatively new sector, the M2M connecti...

Keeled → Akadeemiline inglise keel
16 allalaadimist
Projekt
11
pdf

Projekt

Tallinna Tehnikaülikool Raadio- ja sidetehnika instituut Projekt ainetes ,,IRT0030 Andmeside" ja ,,IRT0100 Kommunikatsioonivõrkude struktuurid ja teenused" teemal «VoIP teenus» Üliõpilane: Ruslan Karpovits Õpperühm: IATM Matrikli nr: 050829 Õppejõud: Avo Ots Tallinn 2008 Author's word This project is written to show some interesting aspects of working with VoIP (Voice over Internet Protocol) service. The project briefly describes the process of finding a solution for based VoIP proble...

Informaatika → Andmeside
69 allalaadimist
Personali juhtimise kodutöö-mitmekesisus organisatsioonis inglise keeles
4
docx

Personali juhtimise kodutöö, mitmekesisus organisatsioonis inglise keeles

Diversity in organization: the case of Office of Naval Research Human Resources Management and Organization Behaviour homework Darja Kristina Vester My work is mostly based on a book "Building a Diverse Work Force: Scientists and Engineers in the Office of Naval Research, which was written by Committee to Study Diversity in the Scientific and Engineering Work Force of the Office of Naval Research, National Research Council in 1997. The Office of Naval Research has for 50 years been in the forefront of research and development in the USA, especially in the physical sciences and engineering. Predating the National Science Foundation, ONR is one of the oldest federal agencies whose mission is to fund external research and development in support of national security needs. It continues today to be viewed as a premier R&D organization where the best science and engineering is ident...

Majandus → Personali juhtimine ja...
9 allalaadimist
Inglise keel unit 5 answers
276
docx

Inglise keel unit 5 answers

1. (a) (i) gene length of DNA; codes for a (specific), polypeptide / protein / RNA; max 1 allele alternative form of a gene; found at a, locus / particular position on, a chromosome; max 1 (ii) assume allele refers to coat colour allele (coat colour) gene / alleles, only on X chromosome; A no (coat colour), gene / allele, on Y chromosome male cats, XY / only have one X chromosome; males have only one (coat colour) allele / cannot have two (coat colour) alleles; need black and orange alleles for tortoiseshell colour; 2 r r w w (b) parental genotypes C C × C C ; r w ...

Keeled → Inglise keel
13 allalaadimist
Vormistamine ülesanne 2
20
docx

Vormistamine ülesanne 2

VORMISTAMISE ÜLESANNE 2 TUNNITÖÖ Õppeaines: SISSEJUHATUS ERIALASSE Tehnoloogia ja ringmajanduse instituut Õpperühm: Juhendaja: Tallinn 2021 SISUKORD 2 ABSTRACT Pilling is an undesired defect of textile fabrics, consisting of a surface characterized by a number of roughly spherical masses made of entangled fibers. Mainly caused by the abrasion of fabric surface occurring during washing and wearing of fabrics, this defect needs to be accurately controlled and measured by companies working in the textile industry. Pilling measurement is traditionally performed using manual procedures involving visual control of fabric surface by human experts. Since the early nineties, great efforts in developing automatic and non-intrusive methods for pilling measurement have been made all around the world with the final aim of overcoming traditional, visual-based a...

Informaatika → Andme-ja tekstitöötlus
2 allalaadimist
Stonehenge - lühikokkuvõte inglise keeles
8
docx

Stonehenge - lühikokkuvõte inglise keeles

STONEHENGE Stonehenge is surely Britain's greatest national icon, symbolizing mystery, power and endurance. Its original purpose is unclear to us, but some ...

Ajalugu → British history (suurbritannia...
22 allalaadimist
Formaldehyde
11
doc

Formaldehyde

Formaldehyde Formaldehyde is a colorless, flammable gas at room temperature. It has a pungent, distinct odor and may cause a burning sensation to the eyes, nose, and lungs at high concentrations. Formaldehyde is also known as methanal, methylene oxide, oxymethylene, methylaldehyde, and oxomethane. Formaldehyde can react with many other chemicals, and it will break down into methanol (wood alcohol) and carbon monoxide at very high temperatures. Formaldehyde is naturally produced in very small amounts in our bodies as a part of our normal, everyday metabolism and causes us no harm. It can also be found in the air that we breathe at home and at work, in the food we eat, and in some products that we put on our skin. A major source of formaldehyde that we breathe every day is found in smog in the lower atmosphere. Automobile exhaust from cars without catalytic converters or those using oxygenated ...

Keeled → Inglise keel
4 allalaadimist
Business peciliarities in Ukraine and Bealrus
106
pdf

Business peciliarities in Ukraine and Bealrus

TRADERUN MOODUL TRADERUN MODULE BUSINESS PECULIARITIES IN THE EU, RUSSIA AND EASTERN PARTNERSHIP COUNTRIES ÄRI ERIPÄRAD EUROOPA LIIDUS, VENEMAAL JA IDAPARTNERLUSRIIKIDES Lecturers: Ryhor Nizhnikau (responsible) Giorgi Gaganidze, Sergei Proskura, Andres Assor P2EC.00.202 (UT code), RIE 7044 (TLU code) Reading materials: Business peculiarities in Ukraine and Belarus Lugemismatejal: Äri eripärad Ukrainas ja Valgenenes Created by Andres Assor Tartu 2013 TABLE OF CONTENTS INTRODUCTION ................................................................................................................... 4 1. UKRAINE ...................................................................................................................

Keeled → Inglise keel
4 allalaadimist
Arvuti arhitektuur ja riistvara testide konspekt
72
pdf

Arvuti arhitektuur ja riistvara testide konspekt

Arvuti riistvara  1. Arvutustehnika ajalugu  a. Kes on nende kuulsate sõnade autor(id)? ­ “640K mälu peaks olema piisav  kõikidele.”  ■ Vastus: Bill Gates  b. Milline oli esimene kommertsmikroprotsessor?  ■ Vastus: 4004  c. Milline oli esimene tabelarvutusprogramm?  ■ Vastus: VisiCalc  d. Milline nendest firmadest esitles esimesena WYSIWYG konsteptsiooni?  ■ Xerox  e. Milline nendest firmadest valmistas esimese 32­bitise protsessori?  ■ National Semiconductor  f. Milli(ne/sed) arvuti(d) aitasi(d) briti valitusel II maailmasõja ajal murda koode?  ■ Colossus  g. Milline organisatsioon lõi WWW esialgse spetsifikatsiooni?  ■ CERN  2. Arvuti, mis see on?  3. Protsessorid 1  4. Protsessorid 2  a. vahemälu ­ Smart Cache  b. tr...

Informaatika → Arvuti arhitektuur
129 allalaadimist
IT Strateegia IT Ettevõttele
24
pdf

IT Strateegia IT Ettevõttele

Table of Contents 1. Background ..............................................................................................................................2 2. Business Plan............................................................................................................................2 2.1. Mission..............................................................................................................................2 2.2. Values ...............................................................................................................................2 2.3. SWOT Analysis of the Organization ................................................................................2 2.4. Opportunities ....................................................................................................................3 2.5. Primary Processes .........................................

Informaatika → Informaatika
58 allalaadimist
Inglise keele kodulugemine teemal-Mass Media
8
doc

Inglise keele kodulugemine teemal: Mass Media

Mass Media What is Mass Media? Statistics show that there are few things which impact the human mind more than mass media. The advice of teachers, parents and relatives may fall on deaf ears, but the mass media influence holds us all spellbound! At this point, it becomes necessary to define mass media. Mass media may be defined as any form of communication which is meted out to the people at large, through the various forms of communication. What modes of communication are we talking about? Well there can be no static definition for the channels of mass communication as they are increasing all the time. But any form of communication which is seen and understood by a large mass of people can be taken to mean mass communication or mass media channels. Why is mass media so attractive to people? Mass media holds a kind of mystique in the minds of the people. It is because the communication is designed in ...

Keeled → Inglise keel
34 allalaadimist
Green Energy presentation
36
ppt

Green Energy presentation

Green Energy Program paid for and brought to by -Anja Bananja -Franz the Manz - And Just Chadrick Overview- What is Green Energy? Different Types? What is sustainability? German Green Energy Cost and Efficiency Recycling What is Green Energy? -It is energy resources that are renewable -Can be naturally replenished -Clean, Safe and not harmful to the environment (aka mother earth) Types of Green Energy Green Energy going cute Solar Power · Is produced by using photovoltaic cells, which capture sunlight and turns that into energy. Problems ? -The sun has got to shine -The cost of solar panels and the systems range between $20k-40k -The light from the sun produces a very small amount of energy Wind Power -These giant pinwheels spin from strong winds which spins ...

Keeled → Inglise keel
7 allalaadimist


Sellel veebilehel kasutatakse küpsiseid. Kasutamist jätkates nõustute küpsiste ja veebilehe üldtingimustega Nõustun