Pure Competition Competition The word "competition" may be used in two ways: rivalry (synonym; opposition, antagonism) structural competition or "pure competition" The main characteristics of competition: 1. Number of firms 2. Type of product 3. Control over price 4. Conditions of entry 5. Nonprice competition 6. Information flow Pure Competition · Involves very large numbers of sellers and buyers. · Firms producing identical or homogeneous products. · Standardized product (a product identical to that of other producers). (ex. corn or cucumbers). · Free Entry and Exit: no significant legal, technological, financial, or other obstacles prohibiting new firms from selling their output in any competitive market N...
Dear Thailand Getaway representative I am writing to you regarding my recent holiday with you and I have some problems in this regard. The holiday you advertised included snorkelling, but it turned out that you did not have the necessary equipment that I had to buy for myself. Bicycle rental was also part of the holiday package, but unfortunately there were no free bicycles to rent, which made me spend too much on transport. Also, the ride with the elephants did not go as planned, because the queue was long and I had to wait a very long time. I was also very disappointed by the beach, because the beautiful sandy beach you promised turned out to be dirty and very crowded. As this holiday not only caused me inconvenience and frustration, but also caused additional costs, I request you to compensate the costs incurred in the amount of 150 euros. I look forward to receiving your response. Yours faithfully, Mari Mets
Cost Accounting. Chapter 1 Management accounting measures, analyzes, and reports financial and no financial information that helps managers make decisions to fulfill the goals of an organization. Financial accounting focuses on reporting to external parties such as investors, government agencies, banks and suppliers. It measures and records business transactions and provides financial statements that are based on GAAP. Cost accounting measures, analyzes, and reports financial and no financial information relating to cost of acquiring or using resources in an organization. Value-chain analysis: sequence of business functions in which customer usefulness is added to products and services. 1. Research and development 2. Design of products, services, or processes 3. Production 4. Marketing 5. Distribution 6. Customer service. Supply chain describes the flow of goods, services, and information from the initial sources of materials and servic...
Solar power What is solar power? Solar power is the energy, which is derived from solar radiation energy. Mainy used to heat and power production, but as well as natural lighting. Solar power released as a result of fusion reactions taking place in the sun. What is solar power? Päikeseenergia on energia, mis on saadud päikesekiirguse energiast. Põhiliselt kasutatakse seda soojuse ja elektri tootmiseks aga ka loomulikus valgustuses. Päikeseenergia vabaneb päikesel toimuvate termotuumareaktsioonide tulemusel. Using heat production production of electricity from solar energy Kasutamine: Soojuse tootmiseks (sh. tarbevee ja joogivee kütmiseks) kasutatakse päikesekütteseadmeid. Elektri tootmine päikeseenergiast võib toimuda fotoelement- ehk fotogalvaanilises elektrijaamas päikesepatareidega või päikese-soojuselektrijaamades läbi soojuse. ...
Using computers for school subjects Nowadays everything is becoming computerized. Many schools let students use computers for their school subjects. I believe that it is a good thing to have such an opportunity, but I don't think they should use computers for every school subject. Firstly, it is not necessary to have computers in every class. It is normal to have computers in Information Technology classroom, where students learn to use computers for their own good. Sitting in front of a computer screen all day, every day, is bad for students' health, it can damage their eyesight. Also, it will be too expensive. It would be difficult to buy computers for every student. Setting up and updating the software will create additional costs. If schools buy too many computers, there may not be left money to pay salaries for the teachers. Will it ensure the high quality of teaching? On the...
The costs of production Production Decisions about production require individual agents to make decisions about the allocation and use of physical inputs. · Objectives of agents, technology, availability and quality of inputs determine the nature of these decisions. Since the objectives are often pecuniary, it is often necessary to relate the decisions about the physical units of inputs and outputs to the costs of production. · If the prices of the inputs and the production relationships are known (or understood), it is possible to calculate or estimate all the cost relationships for each level of output. In ...
Television Advertising Pros and Cons According to a recent study by Ball State University on the media consumption habits of average Americans, despite the Internet's steady rise in popularity over the last few years, television remains the dominant medium in most U.S. households. On average, the general population spends over four and a half hours a day in front of the tube, making TV watching one of the most common modern leisure activities. Is it any wonder then that television advertising is also the most powerful form of advertising? Advertising on television allows you to show and tell a wide audience your business, product, or service. It allows you to actually demonstrate the benefits of ownership. You can show how your product or service works and how it's packaged so prospective customers will know what to look for at the point of sale. In advertising, it often takes multiple touch points to effectively influence consumers' p...
Global Warming One of the biggest issues our planet and its inhabitants are facing nowadays is global warming. Global warming, also often referred to as the greenhouse effect, has not always been a problem. However, over the last centuries, since the Industrial Revolution things have changed. Polar regions are melting, species are dying, climate zones are shifting, migration patterns for animals such as polar bears and birds are being disrupted our world as we know it is changing. Some scientists believe that the climate will reach a tipping point, a point at which even a tiny additional increase would throw the system into violent change. We started doing harmful things and only now do we realize what we have done and what we are doing. At this current rate by the middle of next century the Earth's temperature may rise a predicted from 2 to 6 degrees Celsius. This may not seem as much but with the E...
ELEKTROENERGEETIKA INSTITUUT Referaat Taastvad Energiaallikad Esitamise tähtaeg 14.04.2009 Õppejõud: Hannes Agabus Tudeng: Sergei Belosapko Nikita Naumov Tallinn 2009 Contents: 1. Renewable energy 1.1. Costs................................................................................................................... 2 1.2. Potential future utilization..............................................................................4 1.3. Why Don't We Use More Renewable Energy? ...........................................5 2. Energy Types 2.1. Wind Energy.......................................................................................................6 2.1.1. Annual Generation........................................................................................7 2.1.2. ...
Tallinna Majanduskool ,,Notes on preparing a marketing plan" Homework 03.05.2012 Liisi Nigul Turundus II Tallinn 2012 Toscana Gourmet is a place for family togetherness and will also be the leading gourmet Italian restaurant in Tallinn. The signature line of innovative, premium, pasta and risotto dishes include pesto with smoked salmon, pancetta and peas linguini in an special sauce, and fresh mussels and clams in a marinara sauce. Toscana also serves distinct salads, desserts, and beverages. Toscana Gourmet will reinvent the Italian food experience for individuals, families, and take out customers with discretionary income by selling high quality, innovative products at a reasonable price, designing tasteful, convenient locations, and providing excellent customer service. The basic mark...
Tallinna Tehnikaülikool Raadio- ja sidetehnika instituut Projekt ainetes ,,IRT0030 Andmeside" ja ,,IRT0100 Kommunikatsioonivõrkude struktuurid ja teenused" teemal «VoIP teenus» Üliõpilane: Ruslan Karpovits Õpperühm: IATM Matrikli nr: 050829 Õppejõud: Avo Ots Tallinn 2008 Author's word This project is written to show some interesting aspects of working with VoIP (Voice over Internet Protocol) service. The project briefly describes the process of finding a solution for based VoIP proble...
RAHVUSVAHELINE OSTU-MÜÜGILEPING Õppeaines: TARNEAHELA HALDAMINE Tallinn 2012 SISUKORD A-1 GOOD SOLD..............................................................................................................................................................5 A-2 CONTRACT PRICE (ART. 4)...................................................................................................................................5 A-3 DELIVERY TERMS..................................................................................................................................................5 A-5 INSPECTION OF THE GOODS BY BUYER (ART. 3)...........................................................................................6 A-6 RETENTION OF TITLE (ART. 7)..............................................................................................................................
Rational Use of Diagnostic Tests Screening tests Diagnostic tests are often used to screen asymptomatic patients and identify risk factors for occult disease. Screening tests should be generally noninvasive, inexpensive, and of minimal risk to the patient. Screening tests should have high diagnostic sensitivity, which means few false negative results would be expected, as the goal of testing is to rule out the presence of disease. Screening tests should be used to screen for diseases that (1) have serious consequences if left undetected, (2) are reasonably prevalent within the population, and (3) have treatment options readily available. Should a positive result be obtained, a more accurate, confirmatory test should then be performed. One example of a screening test would be the urine cortisol-to-creatinine ratio (Cort:Crt)u, which is used to screen symptomatic patients for canine hyperadrenocorticism.[1,2] The (Cort:...
BUSINESS PLAN MP CANNED FOOD LIMITED 2018 Business and owner details Business name MP CANNED FOOD LIMITED Owner(s) name MARTIN PÕLD Business address and postcode 12 CARLISLE STREET LEICESTER LE3 6AF Business telephone number +447726779223 Business email address [email protected] Home address and postcode (if different from the above) Executive summary 1.1 Business summary: My business idea is simple: MP CANNED FOOD LIMITED is importing canned food (meat products and ready meals) from Estonia to the United Kingdom. Unique products like "Wild Boar In Its Own Juice", "Elk In Its Own Juice" and "Venison In Its Own Juice" are hard to find in the United Kingdom. We are selling Rannarootsi and Frank Pott brands and sell them online, http://www.mpwildgame.co.uk Future plans are to start trading also in Leicester Market in November/December as a Market Stall, supplying deli shops (including North European and Internation...
BARRIERS TO DISTRICT HEATING DEVELOPMENT IN SOME EUROPEAN COUNTRIES Abstract District heating (DH) offers low primary energy demand, high security of supply and small CO 2 emissions. Barriers to DH in the UK, Ireland, France, Romania and the Czech Republic have been compiled through publications and interviews. DH systems require large investments, have negative initial cash flow and long payback time, which obstructs financing. One actor should control DH from source to consumption. If the value chain is fragmented, contracts are required between the links. It increases risks and financing costs, like in the UK and Ireland, where DH is not established. There are few multi- family houses with central heating and it is expensive to build DH networks in built areas. Most French DH systems are operated according to long-term concessions by companies that sell electricity and gas. No strong actor provid...
TALLINN UNIVERSITY OF TECHNOLOGY SUSTAINABILITY REPORTING GUIDELINES Report Composers: Meelika Koitjärv EABM03 000502 Sandra Oisalu EABM03 000484 Tallinn 2004 2 PREFACE The Board of Directors of the Global Reporting Initiative (GRI) is pleased to release the 2002 Sustainability Reporting Guidelines. From an institutional perspective, it marks the beginning of the cycle of release, testing, review, and revision under GRIs new governance structure. The GRI was launched in 1997 as a joint initiative of the U.S. non-governmental organisation Coalition for Environmentally Responsible Economies (CERES) and United ...
1 Wave energy Introduction to wave energy There are several possibilities to harvest different forms of energy from the sea. One of these options is the usage of waves for the generation of electricity. The devices needed to perform this task are called wave energy converters. Wave energy is indirect solar energy in twice. At first there is the wind, which is caused by variations in atmospheric pressure due to a differential solar heating of earth's surface by the sun. Different regions of pressure drives a force which rises a movement of atmospheric air masses that causes the earths wind system. If wind strikes over the surface of an open water, waves are induced. First they are very flat with only a low level of energy. When there is a long distance over the water on which wind can attack the small ones, they became bigger and bigger with a l...
Tarkvaratehnika 1. Loeng Kvaliteetse tarkvara atribuudid: 1. Teostab ettenähtud funktsionaalsust 2. Hooldatav Tarkvara peab arenema, et vastata muutuvatele vajadustele. 3. Usaldusväärne Töökindlus ja turvalisus. 4. Vastuvõetav Kasutajad on aktsepteerinud selle. Tarkvara on neile arusaadav, kasutatav ja ühilduv teiste süsteemidega. Mis on tarkvaratehnika? Tarkvaratehnika on tiimide poolt rakendatav distsipliin tootmaks kõrgekvaliteedilist, suuremastaabilist ja hinnaefektiivset tarkvara, mis rahuldab kasutajate nõudmisi ja mida saab hooldada teatud ajaperioodi vältel. Tarkvaratehnika on süstemaatilise, distsiplineeritud ja mõõdetava lähenemisviisi rakendamine tarkvara arendamisele, käitamisele ja hooldamisele, see tähendab, inseneriteaduste rakendamine tarkvarale. Tarkvaraarendus on nõrgem termin, kus tingimata ei kasutata protsesse, tööriistu, standardeid jne Mis o...
1. Social Policy aspects in EU Treaties Social and employment policy: Objectives: - The promotion of employment - Improved living and working conditions - Proper social protection - Dialogue between management and labour - The development of human resources with a view to lasting high employment and the combating of exclusion. Treaty of Rome: belief that improved working and living conditions would arise from the functioning of the common market – cooperation in the areas of employment, labour law and working conditions, vocational training, social security, occupational health and safety, and social dialogue. Improved mobility and professional opportunities of employees and introduced the equal pay for men and women – directly applicable. Single European Act: harmonisation of health and safety conditions at work; possibility for social partners at European level to negotiate collective agr...
5. Financial Institutions and Services Objectives and Outcomes To give overview of main players. 5.1. Introduction It is common to distinguish between monetary financial institutions (MFIs) and other financial intermediaries. The distinction is based on the functions of institutions institutions in the first group (MFIs) play important role in the process of money creation in modern economies. European Central Bank (ECB) describes Monetary financial institutions as including national central banks (and also ECB in the euro area), credit institutions and non-credit institutions which receive deposits from general public (individuals and non-MFI firms) and grant credit and/or invest in securities. Major non-credit MFIs in Europe are money market funds. Credit institutions are defined in the directive 1 relating to the taking up and pursuit of the business of credit institutions as: a) undertakings whose business...
An overview of integrated care in the NHS What is integrated care? Research report Sara Shaw, Rebecca Rosen and Benedict Rumbold June 2011 Nuffield Trust work on integrated care This report is part of the Nuffield Trust's extensive programme of work on integrated care, which is examining the potential of new forms of care that are intended to benefit patients and taxpayers. Other related projects include: ·Integration in action: four international case studies. A study of four international organisations that have attempted to improve integration between health and care services. Interviews, documentary analysis and literature review are used to identify the main stimuli for integration and the issues that help or hinder progress; drawing out lessons for the NHS. ·Towards integrated care in Trafford. A project that looks at the process of change and lessons learned to date in Trafford, where NHS organisations have been worki...
Tallinn English College Topic The United States of America Form Tallinn 2005 Introduction The United States of America is a very big country. Its territory is about 9.4 million square kilometres and its population is more than 260 million people, 12% of them are the Afro-Americans. It is the world's third-largest country by size and by population. The population density is about 27 people per square kilometre. Most of the people live in towns. There are 50 states in America. The biggest of the state is Texas, next by size are California, Alaska and Montana. Six states - Maine, Vermont, New Hampshire, Connecticut ,Rhode Island and Massachusetts are called New England. They are all small states in the U.S. that lie in the north-east. The first colony of immigrants settled down in Virginia, in the eastern part of the U.S.A. The...
Introduction The United States of America is a very big country. Its territory is about 9.4 million square kilometres and its population is more than 260 million people, 12% of them are the Afro-Americans. It is the world's third-largest country by size and by population. The population density is about 27 people per square kilometre. Most of the people live in towns. There are 50 states in America. The biggest of the state is Texas, next by size are California, Alaska and Montana. Six states - Maine, Vermont, New Hampshire, Connecticut ,Rhode Island and Massachusetts are called New England. They are all small states in the U.S. that lie in the north-east. The first colony of immigrants settled down in Virginia, in the eastern part of the U.S.A. The biggest cities are New York, Washington, Chicago, Los Angeles, San Francisco, etc. The official language of the USA is English; Spanish is also...
Edith D. de Leeuw, Joop J. Hox, Don A. Dillman INTERNATIONAL HANDBOOK OF SURVEY METHODOLOGY ÜLESANNE Õppeaines: SISSEJUHATUS ERIALASSE Tehnoloogia ja ringmajanduse instituut Õpperühm: Juhendaja: Tallinn 2021 TABLE OF CONTENTS 2 1 THE CORNERSTONES OF SURVEY RESEARCH 1.1 Introduction The idea of conducting a survey is deceptively simple. It involves identifying a specific group or category of people and collecting information from some of them in order to gain insight into what the entire group does or thinks; however, undertaking a survey inevitably raises questions that may be difficult to answer. How many people need to be surveyed in order to be able to describe fairly accurately the entire group? How should the people be selected? What questions should be asked and how should they be posed to...
Report of SCOTLAND Maiki Joakit 10. klass 2008 Etymology Scotland is from the Latin Scoti, the term applied to Gaels. The Late Latin word Scotia (land of the Gaels) was initially used to refer to Ireland. By the 11th century at the latest, Scotia was being used to refer to (Gaelic-speaking) Scotland north of the river Forth, alongside Albania or Albany, both derived from the Gaelic Alba. The use of the words Scots and Scotland to encompass all of what is now Scotland became common in the Late Middle Ages. History Repeated glaciations, which covered the entire land-mass of modern Scotland, have destroyed any traces of human habitation that may have existed before the Mesolithic period. It is believed that the first post-glacial groups of hunter-gatherers arrived in Scotland around 12,800 years ago, as the ice sheet retreated after the last glaciation. Groups of settlers began building the first known permanen...
TRADERUN MOODUL TRADERUN MODULE BUSINESS PECULIARITIES IN THE EU, RUSSIA AND EASTERN PARTNERSHIP COUNTRIES ÄRI ERIPÄRAD EUROOPA LIIDUS, VENEMAAL JA IDAPARTNERLUSRIIKIDES Lecturers: Ryhor Nizhnikau (responsible) Giorgi Gaganidze, Sergei Proskura, Andres Assor P2EC.00.202 (UT code), RIE 7044 (TLU code) Reading materials: Business peculiarities in Ukraine and Belarus Lugemismatejal: Äri eripärad Ukrainas ja Valgenenes Created by Andres Assor Tartu 2013 TABLE OF CONTENTS INTRODUCTION ................................................................................................................... 4 1. UKRAINE ...................................................................................................................
Bioinformaatika ülesanded Järjestuste võrdlemine, otsingud andmebaasidest (BLAST, FASTA, SW). 1. BLAST programmide kasutamine tundmatu valgujärjestuse identifitseerimiseks või sarnaste valgujärjestuste leidmiseks (http://www.ncbi.nlm.nih.gov/BLAST/). Programmide kasutamisel tutvuda tutorialite ja juhenditega!!! (http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/information3.html). a. Otsida sarnaseid järjestusi antud valgujärjestusele. Valida sobiv programm vastavalt NCBI juhendile valgujärjestuse võrdlemiseks valgujärjestuste seast. Valida otsimiseks Refseq andmebaas, sooritada otsing, tulemuste formaat 500 joondamise jaoks. GTESPLLTDPSTPNFFWLAWQARDFMSKKYGQPVPDRAVSLAINSRTGRTQNHFHIHISCIRPDVRKQLDNNLAN ISSRWLPLPGGLRGHEYLARRVTESELVQRSPFMMLAEEVPEAREHMGRYGLAMVRQSDNSFVLLATQRNLLTLN RASAEEIQDHQCEILRMRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEM...
Tallinn University Natural and exact sciences Molecular Biochemistry and Ecology Maria Gnidenko Capillary electrophoresis Essay Supervisor: Kert Martma Tallinn 2015 Table of contents Acronyms and symbols used Introduction History and development Physical basis and principle of separation Elektrophoresis Electroosmotic flow Separation process Electrodispersion Various methods of separation Capillary zone electrophoresis (CZE) ...
TRADERUN MOODUL TRADERUN MODULE BUSINESS PECULIARITIES IN THE EU, RUSSIA AND EASTERN PARTNERSHIP COUNTRIES ÄRI ERIPÄRAD EUROOPA LIIDUS, VENEMAAL JA IDAPARTNERLUSRIIKIDES Lecturers: Ryhor Nizhnikau (responsible) Giorgi Gaganidze, Sergei Proskura, Andres Assor P2EC.00.202 (UT code), RIE 7044 (TLU code) Reading materials: Business peculiarities in Russia Lugemismatejal: Äri eripärad Venemaal Created by Sergei Proskura Tartu 2013 TABLE OF CONTENTS INTRODUCTION ....................................................................................................................................... 3 1. LEGALIZATION OF A COMPANY WITH A FOREIGN OWNER IN RUSSIA ....................................... 4 1.1. Laws ....
1. OBJECT-ORIENTED PARADIGM The Model •The model defines an abstract view to the problem. This implies that the model focuses only on problem related stuff and that you try to define properties of the problem. These properties include: 1 •the data which are affected and 2 •the operations which are identified by the problem. Object-oriented Paradigm •Everything is an object •A program is a bunch of objects telling each other what to do by sending messages •Each object has its own memory made up of other objects •Every object has a type •All objects of a particular type can receive the same messages Domain Model •A domain model does not represent the entire domain as it is in the real world. It includes only the concepts that are needed to support the application. Object •Is a partitioned area of memory where object code is stored •The area of memory is protected •This code can function relatively independently of othe...
Statistiline modelleerimine – kokkuvõte Muutujad: Sõltuvad muutujad (dependent, outcome variables) – muutujad, mis on uurimise keskmes, millele uurija arvab, et teised muutujad mõju avaldavad. Nö katseisikust sõltuv muutuja. Sõltumatud muutujad (independent, predictor variables) – muutujad, mille kohta uurija arvab, et neil võiks olla mõju uuritavatele muutujatele. Statistilise analüüsi keskmes on uurida, kuidas teatud tunnused koos muutuvad. Kui on vaja muutujat iseloomustada, on kaks põhilist viisi, kuidas seda teha: o Milline on selle muutuja tüüpiline väärtus? o Kui hästi iseloomustab see tüüpiline väärtus kõiki mõõdetud juhtumeid? Ehk kui palju on varieeruvust selle tüüpilise väärtuse “ümber”? Statistika jagunemine: Kirjeldav statistika (descriptive stat.) meetodid andmetest kokkuvõtete tegemiseks ning kirjeldamiseks. („65-70% US...
Silicon Valley Could you reproduce Silicon Valley elsewhere, or is there something unique about it? It wouldn't be surprising if it were hard to reproduce in other countries, because you couldn't reproduce it in most of the US either. What does it take to make a silicon valley even here? What it takes is the right people. If you could get the right ten thousand people to move from Silicon Valley to Buffalo, Buffalo would become Silicon Valley. That's a striking departure from the past. Up till a couple decades ago, geography was destiny for cities. All great cities were located on waterways, because cities made money by trade, and water was the only economical way to ship. Now you could make a great city anywhere, if you could get the right people to move there. So the question of how to make a silicon valley becomes: ...
EU Internal Market Law Mid-term online evaluation assignment for Distance Learning Students The Assignment: Hypothetical Case In the Member State A several NGOs, uniting parents concerned with safety of children and young adults, ordered a study of dog attacks on people (and especially children) resulting in deaths or maiming. The aim of the study was to identify, if possible, the dog breeds of potentially enhanced danger for people. The study’s results showed that pit bulls and their close mixes as well as Rottweilers and their close mixes were jointly responsible for over 70% of attacks. The authors of the study explained the statistics by popularity, big size and powerfulness of the named breeds and their ability to do a lot of damage. Besides, about the pit bull attacks the absence of warning from a dog played a significant role, because due to the custom of docking (cutting short) pit bulls’ tails warning signals could n...
EHITUSTEADUSKOND Ehitustootluse instituut KUIDAS MUUDAB MUDELPROJEKTEERIMINE TERASKONSTRUKTSIOONIDE PROJEKTEERIMIST, VALMISTAMIST JA EHITAMIST? HOW ARE 3D AND BIM CHANGING THE DESIGN, FABRICATION AND CONSTRUCTION OF COMPLEX STEEL STRUCTURES? EPJ 60 LT Üliõpilane: Tanel Friedenthal Juhendaja: Prof. Roode Liias Kaasjuhendaja: Prof. Carrie S. Dossick Tallinn, 2010.a. Olen koostanud lõputöö iseseisvalt. Kõik töö koostamisel kasutatud teiste autorite tööd, olulised seisukohad, kirjandusallikatest ja mujalt pärinevad andmed on viidatud. …………………………………………….. (töö autori allkiri ja kuupäev) Üliõpilase kood: 041399 Töö vastab magistritööle esitatud nõuetele ……………………………………………… ...
Investor's Handbook A Legal Guide to Business in Georgia · Start Up · Privatization · Labor Legislation February 2011 1st Edition 1 CYAN MAGENTA YELLOW BLACK 1 This brochure is a publication by the Georgian National Investment Agency (GNIA) and was prepared by Georgian law firm Mgaloblishvili, Kipiani, Dzidziguri (MKD). The Brochure is intended to be a general guidance on start up, privatization and labor relations. It is thus not expected to be a substitute for detailed research or exercise of professional judgment on above mentioned topics. Companies and individuals operating in Georgia or planning to operate, are strongly advised to obtain current and detailed information from experienced professionals. None of the organizations mentioned above, nor their members, employees o...
Games Programming with Java and Java 3D Andrew Davison Dept. of Computer Engineering Prince of Songkla University HatYai, Songkhla 90112 E-mail: [email protected] Draft: 14th January 2003, #2 Abstract This article looks at the advantages and disadvantages of using Java and Java 3D for games programming. It assumes the reader is familiar with Java, but presents short overviews of gaming, the low-level APIs OpenGL and DirectX, and Java 3D. No programming examples are included here, although links to online code are supplied. 1. Background to Gaming Giving a definition for `computer game' is problematic, due to the wide range of game types. For example, the ArcadePod site (http://www.arcadePod.com) divides its hundreds of Java games into more ...
ENVIRONMENTAL PROBLEMS Our environment is constantly changing. However, as our environment changes, so does the need to become increasingly aware of the problems that surround it. With a massive influx of natural disasters people need to be aware of what types of environmental problems our planet is facing. Current environmental problems make us vulnerable to disasters and tragedies, now and in the future. Unless we address the various issues seriously we are surely doomed for disaster. Current environmental problems require urgent attention. 1. Pollution: Pollution of air, water and soil require millions of years to recoup. Industry and motor vehicle exhaust are the number one pollutants. Heavy metals, nitrates and plastic are toxins responsible for pollution. While water pollution is caused by oil spill, acid rain, urban runoff; air pollution is caused by various gases and toxins released ...
Ergo Pikas Integration of Lean Construction and Building Information Modelling DISSERTATION Tallinn 2010 2 UNIVERSITY OF APPLIED SCIENCES Author: Ergo Pikas- Civil Engineering student, Faculty of Construction, Tallinn University of Applied Sciences Supervisor: Rafael Sacks- Associate Professor, Faculty of Civil and Env. Engineering, Technion Israel Institute of Technology Consultant: Roode Liias- Professor and Dean, Faculty of Civil Engineering, Tallinn University of Technology Title: Integration of Lean Construction and Building Information Modelling Archived: University of Applied Sciences, Faculty of Construction ABSTRACT This research can be divided into two. The first part investigates the current state of the construction industry, ...
PRAISE FOR The 4-Hour Workweek "This is a whole new ball game. Highly recommended." --Dr. Stewart D. Friedman, adviser to Jack Welch and former director of the Work/Life Integration Program at the Wharton School, University of Pennsylvania "It's about time this book was written. It is a long-overdue manifesto for the mobile lifestyle, and Tim Ferriss is the ideal ambassador. This will be huge." --Jack Can eld, cocreator of Chicken Soup for the Soul®, 100+ million copies sold "Stunning and amazing. From mini-retirements to outsourcing your life, it's all here. Whether you're a wage slave or a Fortune 500 CEO, this book will change your life!" --Phil Town, New York Times bestselling author of Rule #1 "The 4-Hour Workweek is a new way of solving a very old problem: just how can we work to live and prevent our lives from being all about work? A world of in nite...
TOPICS For the PRELIM Year 1 Put down 10-12 relevant terms and retell about: 1. Prescriptive and descriptive law Prescriptive law – prescribe how people ought to behave Descriptive law – describes the way people or natural phenomena behave Break the law – do something illegal Penalty – punishment Government – system by which a state or community is controlled Law – the system of rules System of courts – all judicial institutions Enforce – to make people obey the law Authority – a group of people with official responsibility for a particular area of activity /the moral or legal right or ability to control Prescribe – to tell someone what they must have or do, or to make a rule of something Impose The word law can have several meanings, it can be divided into prescriptive and descriptive law. Descriptive law – describes the way people or natural phenomena behave, e. g. law of gravity Prescriptive law – prescribe how people...
Analog Interfacing to Embedded Microprocessors Real World Design Analog Interfacing to Embedded Microprocessors Real World Design Stuart Ball Boston Oxford Auckland Johannesburg Melbourne New Delhi Newnes is an imprint of Butterworth–Heinemann. Copyright © 2001 by Butterworth–Heinemann A member of the Reed Elsevier group All rights reserved. No part of this publication may be reproduced, stored in a retrieval system, or transmitted in any form or by any means, electronic, mechanical, photocopying, recording, or otherwise, without the prior written permission of the publisher. Recognizing the importance of preserving what has been written, Butterworth–Heinemann prints its books on acid-free paper whenever possible. Library of Congress Cataloging-in-Publication Data Ball, Stuart R., 1956– Analog interfacing to embedded microprocessors : real world design / Stuart Ball. p. cm. ISBN 0-7506-7339-7 (pbk...
Tartu Ülikool Filosoofiateaduskond Ajaloo ja arheoloogia instituut Vahur Ilumets MUUTUSED VALGA LINNAS PÄRAST EESTILÄTI PIIRI MÄÄRAMIST Bakalaureusetöö Juhendaja: dotsent Ago Pajur Valga 2011 Sisukord Sissejuhatus 3 Valga linna jagamine 6 Piirivalvest ja piiriületusest 11 Liiklemine ja transport 18 Majandusolud 23 Kokkuvõtte 28 Changes in Valga after d...
Eksami küsimused: 1. Mida tähendab mitmekiireline levi Mitmekiireline levi – info levib mööda peegeldusi, otselevi on väga harva. Kohale jõuab mitu lainet samaaegselt. Halb, sest lained liituvad (võivad tasakaalustada ennast ning signaal kustub ära, nõrgeneb). Kuna inimene liigub, muutub sagedus – lainepikkus – tuleb kogu aeg kanalit järgi kruttida. 2. Mida tähendab alla- ja üleslüli ning dupleks kaugus mobiilsides Pertaining to computer networks, a downlink is a connection from data communications equipment towards data terminal equipment. This is also known as a downstream connection. The uplink port is used to connect a device or smaller local network to a larger network, or connect to the next "higher" device in the topology. For example, the edge switch connects "up" to the distribution layer managed switch. Lühidalt - The communication going from a satellite to ground is called...
More praise for Influence: Science and Practice! "We've known for years that people buy based on emotions and justify their buying decision based on logic. Dr. Cialdini was able, in a lucid and cogent manner, to tell us why this happens." --MARK BLACKBURN, Sr. Vice President, Director of Insurance Operations, State Auto Insurance Companies "Dr. Cialdini's ability to relate his material directly to the specifics of what we do with our customers and how we do it, enabled us to make significant changes. His work has enabled us to gain significant competitive differentiation and advantage" -LAURENCE HOF, Vice President, Relationship Consulting, Advanta Corporation "This will help executives make better decisions and use their influence wisely ... Robert Cialdini has had a greater impact on my thinking on this topic than any other scientist." -CHARLES T...
Handbook of Meat Processing Handbook of Meat Processing Fidel Toldrá EDITOR A John Wiley & Sons, Inc., Publication Edition first published 2010 © 2010 Blackwell Publishing Blackwell Publishing was acquired by John Wiley & Sons in February 2007. Blackwell’s publishing program has been merged with Wiley’s global Scientific, Technical, and Medical business to form Wiley-Blackwell. Editorial Office 2121 State Avenue, Ames, Iowa 50014-8300, USA For details of our global editorial offices, for customer services, and for information about how to apply for permission to reuse the copyright material in this book, please see our website at www.wiley.com/ wiley-blackwell. Authorization to photocopy items for internal or personal use, or the internal or personal use of specific clients, is granted by Blackwell Publishing, provided that the base fee is paid directly to the Copyright Clearance Cent...
Sissejuhatus infotehnoloogiasse 1. Loeng Algoritm on täpne samm-sammuline, kuid mitte tingimata formaalne juhend millegi tegemiseks. Näited: a. Toiduretsept. b. Juhend ruutvõrrandi lahendamiseks Algoritmiline probleem - probleem, mille lahenduse saab kirja panna täidetavate juhendite loeteluna. Programm on formaalses, üheselt mõistetavas keeles kirja pandud algoritm. Arvutid suudavad täita ainult programme. Analoogsüsteem andmeid salvestatakse (peegeldatakse) proportsionaalselt Näit: termomeeter, vinüülplaat, foto Digitaalsüsteem (pidevad) andmed lõhutakse üksikuteks tükkideks, mis salvestatakse eraldi Näit: CD, arvutiprogramm, kiri tähtede ja bittidena Ühelt teisele: digitaliseerimine The three major comparisons of computers are: Electronic computers versus Mechanical computers...
tutvu lausearvutuse keskkonnaga: http://logik.phl.univie.ac.at/~chris/gateway/formular-uk-zentral.html Millistel muutuja väärtustel on lause (Av(B&A))v(-A&(Cv(B&-C))) väär? Panna tuleb results only, 0 on väär 1 on õige Tutvu ajalooga saidis kuni II maailmasõda: http://www.maxmon.com/history.htm Loe läbi jutt ja proovi andmetega mängida: http://math.hws.edu/TMCM/java/DataReps/index.html Kahend süsteemi arvu(101101001) ->kümnend süsteemiks. Nr sisse ja bianarile punkt, ja vaatan base ten integeri kümnendarvudest annab Ecki appletis juuresoleva graafilise kujutise, teen kujundi ja vaatan base integeri mis vastab kahendsüsteemi arvule 1110001 ASCII tabelis? Nr sisse ja punkt bianari, vaatan ...teksti Kümnendsüsteemi arv 33 on kahendsüsteemis? 33 kirjutan ja Base-ten integer, vaatan bianary Loe läbi jutud Atbashi ja Caesari šifri (Caesar cipher) kohta: http://www.wikipedia.org 2 Tutvu ajalooga kuni 1970ndad: http://www.islandnet.com/~...
ccc_tracy_fm_i-xviii.qxd 7/7/03 3:22 PM Page iii CHANGE YOUR THINKING, CHANGE YOUR LIFE How to Unlock Your Full Potential for Success and Achievement B R I A N T R AC Y JOHN WILEY & SONS, INC. ccc_tracy_fm_i-xviii.qxd 7/7/03 3:22 PM Page i CHANGE YOUR THINKING, CHANGE YOUR LIFE ccc_tracy_fm_i-xviii.qxd 7/7/03 3:22 PM Page ii ccc_tracy_fm_i-xviii.qxd 7/7/03 3:22 PM Page iii CHANGE YOUR THINKING, CHANGE YOUR LIFE How to Unlock Your Full Potential for Success and Achievement B R I A N T R AC Y JOHN WILEY & SONS, INC. ccc_tracy_fm_i-xviii.qxd 7/7/03 3:22 PM Page iv ...
The Project Gutenberg EBook of Pride and Prejudice, by Jane Austen This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenberg License included with this eBook or online at www.gutenberg.org Title: Pride and Prejudice Author: Jane Austen Release Date: August 26, 2008 [EBook #1342] [Last updated: August 11, 2011] Language: English Character set encoding: ASCII *** START OF THIS PROJECT GUTENBERG EBOOK PRIDE AND PREJUDICE *** Produced by Anonymous Volunteers, and David Widger PRIDE AND PREJUDICE By Jane Austen Contents Chapter 1 Chapter 22 Chapter 2 Chapter 23 Chapter 43 Chapter 3 Chapter 24 Chapter 44 ...
THE W R I T E R ' S JOURNEY M Y T H I C STRUCTURE FOR W R I T E R S THIRD EDITION CHRISTOPHER VOGLER S C R E E N W R I T I N G / W R I T I N G Christopher Vogler explores the powerful relationship between mythology and storytelling in his clear, concise style that's made i this book required reading for movie executives, screenwriters, playwrights, fiction and non-fiction writers, scholars, and fans of pop culture all over the world. Discover a set of useful myth-inspired storytelling paradigms like "The Hero's Journey," and step-by-step guidelines to plot and • character development. Based on the work of Joseph Campbell, The Writers Jour...
annaabi.ee 
