Vajad kellegagi rääkida?
Küsi julgelt abi LasteAbi
Logi sisse
Sulge

"200 words" - 96 õppematerjali

Summary Education
2
odt

Summary Education

Education The education system is a little bit different in the UK than ours. For example they have go to school 2 years earlier than us. Primary school is for pupils aged 5-11. Though schooling is only compulsory from age 5 in the UK, children most commonly enter Reception Class aged 4 in the academic year in which they will reach their 5th birthday. When pupils are aged 7 they sit Key Stage 1 [SATs]. Key Stage 2 SATs are taken when pupils are aged 11. Secondary school is for pupils aged 11-16. 11-13 years old pupils study a broad range of 10–15 subjects. No public examinations are taken during this time. Traditionally, at the age of 14 students start a programme that lasts for 2 years and during which time they study up to 11 subjects of their choice. After this students take GCSE state examinations After 16 attending at school isn't compulsory but pupils can stay at school, go to coll...

Keeled → British culture (briti...
1 allalaadimist
Report about Steffani Pizza Restaurant
1
doc

Report about Steffani Pizza Restaurant

Report To: David Carlisle From: Mart Mets Date: 11th December 2013 Subject: Steffani Pizza Restaurant Introduction The purpose of this report is to highlight some good and bad points of Steffani Pizza Restaurant. In order to prepare this report I handed out to their recent customers questionnaires in order to get the most recent data. Good points of Steffani Pizza Restaurant Firstly, I have to point out that the customers are very satisfied with the prices and they are probably willing to pay higher prices, if Steffani wants to raise the prices. There is something specail about the atmosphere, because my research show that people spend there about two times more than in other eating places in Pärnu. Secondly, I have to mention that the food is quite delicious. Bad points of Steffani Pizza Restaurant The biggest problem with Steffani seems to be their workers. Actually they are in despe...

Keeled → Inglise keel
31 allalaadimist
Recommendation report about Haapsalu
2
docx

Recommendation report about Haapsalu

To: Ms Maire Liidlein From: Kerli Neljas Date: 16th December Subject: Recommendation report about Haapsalu Introduction Haapsalu is a small, friendly and romantic town is a real summer paradise and in summer a lot of holidaymakers visit this. They come for the warm seawater, curative mud, peacefulness. A lot of people visit the resort every summer, there are many different ways to spent time there, both for tourists and locals. Old Town of Haapsalu and museums People who are interested in culture and history can visit the Old Town and museums. For example the Estonian Railway Museum, the Episcopal Castle Museum, the Läänemaa Museum and others. I think that the city itself is one of the greatest historical places. Nobody can talk about the history of Haapsalu better than the city itself. And visiting museums is a good for acquiring new knowledge, but those people who do not love history, may get bored. And all museums are located relativ...

Keeled → Inglise keel
6 allalaadimist
Internet- Otsimootor
3
rtf

Internet- Otsimootor

NETI GOOGLE ALTAVISTA www.neti.ee www.google.com www.altavista.com Töökeskkonna keel Eesti keel 129 keeles (sh eesti) 28 keeles (va eesti) Abi Üleval paremas nurgas link Abi Link kõik Googlist All Privacy Policy kõrval Kataloog Avalehel link Kataloog (riigiti erinev) Otseselt kataloogi pole Tõstutundlik Ei ole Ei ole Ei ole Pärnu=PÄRNU=pärnu Pärnu=PÄRNU=pärnu Pärnu=PÄRNU=pärnu Vaikimisi otsing AND ...

Informaatika → Informaatika
18 allalaadimist
Essee kirjutamine inglise keeles
6
docx

Essee kirjutamine inglise keeles

Essay 200 (+/- 10%) words The text consists of 4-5 paragraphs discussing a specified topic. Usually the task contains points you have to discuss. Make sure they are all covered! Keep in mind! Formal language – no slang, so contracted forms, colloquialisms, try to avoid repetition of words. Indented lines! Clear paragraphs with one central idea. Avoid strong feelings 8everybody hates... it is absurd to believe...) and strong personal expressions Use generalization (children assume…), but do not use overgeneralizations (all children assume…) At least 2 linking words per paragraph (separate them from the rest of the sentence by commas!) that show the connection between paragraphs. Make references to other sources (Police officials believe that…) Give examples, not personal thoughts (expressive intake of alcohol can damage liver) if you use statistics, be sure of the source! Avoid clichéd introductions, make it more original (hook) Consiste...

Keeled → Inglise keel
36 allalaadimist
Guidelines for writing tasks
4
doc

Guidelines for writing tasks

Writing tasks Formal letters 120 words I Tegemist on ametliku kirjastiiliga ja lühivormid (don't, can't, I'm etc.)on keelatud! Kaotate kohe punkte II * Dear Mr. Smith (ja eesnime ei tohi kirjutada!!!) * Kui teame nime, siis lõpp Yours sincerely ja allkiri ja ülesandes antud nimi * Kui nime pole öeldud, siis Dear Sir or Madam * Kui nime ei tea, siis lõpus Yours faithfully ja allkiri ja ülesandes antud nimi Enda nime ei tohi mitte mingil juhul kirjutada!!!!! Te olete kas Jürid või Marid, Urved või Urmased jne. Kirjade tüübid: 1) Kui peate kirjutama kirja , kus tuleb kelleltki nõu küsida, siis alustage: I am writing to ask if you could help me with... I am writing to ask for your advice... Ja lõpetage I would appreciate if you could give me your advice as soon as possible või I look forward to receiving your advice... 2) Kui peate kirjutama kirja , kus tuleb ise nõustada, siis alustage: I am writing in reply to your letter asking a...

Keeled → Inglise keel
231 allalaadimist
Jamaika referaat
14
doc

Jamaika referaat

Jamaica report FORM: 10A 2009 Contents 1.Introduction........................................................ ....3 2.History................................................................ .....4 3.Geography......................................................... ......6 4.Economy............................................................ .....7 5.Crime................................................................. ......8 6.Sport.................................................................. ......9 7.Language........................................................... ....10 8.Conclusion......................................................... ....11 9.New words............................................................12 10.References...................................................... .....13 Introduction Jamaica is an island nation of the Great...

Keeled → Äriinglise keel
16 allalaadimist
London History
3
doc

London History

LONDON HISTORY PERIOD EVENTS PEOPLE The Celtic period (400 BC ­ Name: Celtic words (Llyn (a lake) + AD 43) Dun (a fort or strong place) ) Not important The Roman occupation (AD 43 Londinium ­ not important Boadicea ­ a revolt against - AD 410) politically. An important trading the Roman conquest centre. Devastation ­ AD 61. Rebuilt. Roman walls built in AD 200. Anglo ­ Saxons (AD 400 ­ Destroyed the Roman towns. Many 1066) kingdoms. London in ruins. King Egbert ­ one Flourishing. Attacks by Vikings. kingdom England (the 9th ...

Keeled → Inglise keel
5 allalaadimist
The Major Environmental Problems In Estonia
1
doc

The Major Environmental Problems In Estonia

The Major Environmental Problems in Estonia The environment and saving it are important topics in today's world. In fact there are often several articles in newspapers and on television about environmental problems all around the world. To begin with, Estonia is a little country with small towns. In spite of that there is pollution. Most of the people here have their own cars and they prefer driving five hundred meters by car than walking by foot. In addition to that pollution is also caused by industries which are often located in towns near peoples' homes. As Estonia belongs to developed countries, people have enough power purchased and they mindlessly buy things they do not even need. According to that there is overconsumption which also causes huge waste dumps. Lastly there is abuse of the natural resources in Estonia. While wasting paper, people do not think that it is made of both wood and water whi...

Keeled → Inglise keel
40 allalaadimist
Reporti kirjutamine
3
doc

Reporti kirjutamine

REPORT What´s the purpose of the report? A report is usually written to give information to somebody who needs it. This means that the writer knows more about the subject than the reader. You may be asked to give information, evaluate something, or make suggestions and recommendations. MAKE YOUR REPORT CLEAR AND SIMPLE. What style should I use? A report is based on facts and/ or data. Think carefully about the best way to present the facts. Be clear and avoid unnecessary detail. Give essential information and recommendations. A report is a formal piece of writing and it is impersonal (avoid using the pronoun " I "). Say what you have to say in as few words as possible. How should I structure a report? Every report, like an essay, should have the following parts: A. INTRODUCTION- state what you are going to write about. If the report is based on a survey, state when and by whom the survey...

Keeled → Inglise keel
1032 allalaadimist
Inglise keele riigieksami vihik 2010 kirjutamise osa
2
docx

Inglise keele riigieksami vihik 2010 kirjutamise osa

Inglise keele riigieksami vihik Kirjutamine Task 1 You have read the following advertisement in Yes! Student magazine. SUMMER CAMP IRELAND Wanted: young people to work in a summer camp for 12-155-year-old children in Ireland. The work includes organising free time activities. If you are interested, write to us about: · who are you · why you are suitable for the job · why you want the position · ask about the work · ask about the place, time and pay Contact: Jane Lake, 888, Bundoran, Ireland Write a letter using all the prompts above. Use the pen-name Mari/Mart Mets for yourself. Do not write any addresses. You shoul...

Keeled → Inglise keel
34 allalaadimist
Presentation - teflon - powerpoint
10
pptx

Presentation - teflon - powerpoint

Polytetrafluoroethylene Teflon Technology of Materials http://www.wisegeek.com/what-is-teflon.htm http://www.3dchem.com/molecules.asp?ID=200 Polytetrefluoroethylene Words: Chain ­ ahel Serendipitously- pooljuhuslikult Resistance- vastupanu insulator-isolaator Semiconductor-pooljuht Deteriorate ­ halvenema Surface-pind Vulnerable- haavatav,nõrk Shield ­kilp, varjama Spin-off ­ kõrval saadus Polytetrefluoroethylene Polyteterfluoroethylene(PTFE) · Background · History · Structure · Properities · Applications · Safety Polytetrefluoroethylene PTFE-Teflon Synthetic fluoropolymer of tetrafluoroethylene Plastic with the good properities Is most well known by the DuPont brand name Teflon. ...

Keeled → Akadeemiline inglise keel
51 allalaadimist
History of the English language
7
doc

History of the English language

Suppletion Present in languages of different families. Present in Old, Middle and Modern English, though the general tendency is towards more regularity/iconicity so the number of suppletive forms has decreased.In the text: goon ­ to go wenden - to turn Gan was suppletive in Old English, past form: eode.Eode was supplanted by went (past form of wenden) at the end of the Middle English period.To wend has survived in Modern English in phrases such as to wend one's way, we wended homewards (ironic usage). Thus: suppletivity- suppletion ­ different parts of one and the same paradigm come from what were originally different paradigms (different words with close meanings or words in different but close dialects).Suppletion embraces verbs, adjectives, nouns. Be ­ was/were ­been (Old English beon/wesan) (am, art, is, are); in Old English some suppletive forms were used parallel to one another) Good ­better ­ best Bad ­ worse ­ worst Much ­ more...

Keeled → Inglise keel
19 allalaadimist
Writing a report-Näidis inglise keele aruande tegemiseks
2
odt

Writing a report/ Näidis inglise keele aruande tegemiseks

Write a report (on a separate sheet of paper) to the Ministry of Education on the sporting facilities in your school. Write about the places, rooms and equipment and PE lessons (number of lessons a week, teachers, trainings) and if anything should be improved. Rules - in notebook, See alsoTB p 202. Write ab. 200 words. To: Ministry of Education From: Mari Mets, student of Mets Gymnasium Subject: The sporting facilities in our school Date: 2 February 2016 Introduction The purpose of this report is to give an overview of sporting facilities in our school and give some recommendations to improve it. My findings are presented below. Places and rooms Teachers would like us to be outside as much as possible, so majority of lessons take place outdoors. Students can have their lessons free at Tehvandi Sports Centre. In case of a bad weather we usually do our lessons in big and modern sports hall. Equipment Students can use different balls and...

Keeled → Inglise keel
32 allalaadimist
Leksikoloogia konspekt-uus
20
doc

Leksikoloogia konspekt (uus)

English lexicology 1. Size of English vocabulary  Vocabulary is a sum total of words used in a language by speakers or for dictionary-making. Active and passive vocabulary.  The Old English vocabulary was homogenous. There were about 50 000 – 60 000 words, 1/3 of which have survived. o About 450 loans from Latin o About 2000 from the Viking invasions.  The Middle-English vocabulary became a heterogeneous hybrid of Germanic and Romanic languages. 100 000 to 125 000 words. o About 10 000 loans from Norman French, 75% are still in use o Continuing Latin influence  Early Modern English. 200 000 – 250 000 words o English becomes a pluricentric language. o Polyglot. Cosmopolitan language  Modern English. 500 000 words o At present at least 1 billion lexical units 2....

Keeled → Inglise keel
14 allalaadimist
Report on Exercises 2 - Diodes
11
pdf

Report on Exercises 2 - Diodes

Tallinn University of Technology Department of Electrical Drives and Power Electronics Report on Exercises 2 Diodes Student ******* Code ****96 Group AAVB41 Tallinn 2012 2.1. Diode rectifier VD f = 9 kHz U=6V U = 19.7 V R = 96 k Figure 1. Circuit diagram Figure 2. Timing diagram VD + R = 96 k...

Tehnika → Elektroonika jõupooljuht...
103 allalaadimist
Inglise keele põhikooli eksam 2010 lugemise osa
5
doc

Inglise keele põhikooli eksam 2010 lugemise osa.

Põhikooli inglise keele eksam 2010 LUGEMINE Task 1 (5 points) Read the notices below and tick ( )the correct answer A, B , C , or D. An example (0) has been done for you. 0. Hotel. Free parking at rear. A You can park next to the hotel. B You can park in front of the hotel. C You can park under the hotel. D Y ou can park behind the hotel. 1. A You can buy a Niagara Falls Coffee mug if you have this voucher. B Many souvenirs are 20% cheaper with this voucher. C All souvenirs are 20% cheaper with this voucher. D You will get a coffee mug 20% cheaper with this voucher. 2. Summer Clearance today! Up to 30 % off many items. A After the sale many items will cost 30% less. B All items are 30% cheaper today. C All items will be 30% cheaper this summer. D Some items are 30% cheaper today. 3. This film is unsuitable for children under 16. A You cannot watch films until you are 16. B T...

Keeled → Inglise keel
70 allalaadimist
Eessõnade kasutamine inglise keeles
6
xlsx

Eessõnade kasutamine inglise keeles

EESSÕNAD ABOVE kohal above the shelf ON peal on the desk on Monday evening UNDER all under the bed BEFORE enne before the meeting AFTER pärast after the movie WITH kellega/ millega connected with the profit FOR eest / jaoks pay for the products for 200 euros DURING kestel, vältel during the seminar FROM ... TO millest milleni from 9 to 5 from the hotel to the beach IN sees in May in the office AT sees, juures at the window akna juures at the dentist's at the airport at school at home at work at the weekend at night at nine o'clock at the beginning of the year TO sisse go to work NEXT TO kõrval ...

Keeled → Inglise keel
4 allalaadimist
Stephen wiltshire
3
odt

Stephen wiltshire

Stephen wiltshire 1 slaid Stephen was born in London, United Kingdom to West Indian parents on 24th April, 1974. As a child he was mute, and did not relate to other people. Aged three, he was diagnosed as autistic. He had no language and lived entirely in his own world. 2.slaid At the age of five, Stephen was sent to Queensmill School in London, where it was noticed that the only pastime he enjoyed was drawing. It soon became apparent he communicated with the world through the language of drawing; first animals, then London buses, and finally buildings. The instructors at Queensmill School encouraged him to speak by temporarily taking away his art supplies so that he would be forced to ask for them. Stephen responded by making sounds and eventually uttered his first word - "paper." He learned to speak fully at the age of nine. His early illustrations depicted animals and cars; he is still extremely interested in american cars and is...

Keeled → Inglise keel
1 allalaadimist
Stonehenge kromlehh
23
ppt

Stonehenge kromlehh

Stonehenge Hort 4000 Mary Laine What is Stonehenge? Derived from words that mean hanging stones, circle of stones, or stone hinges 162 stones originally and about half remain today Southern England, eight miles north of Salisbury and 30 miles north of the English Channel Nearby hillsides are covered with hundreds of burial pits known as barrows 80% of the barrows face east towards where the sun rises on the horizon There are at least 900 circles in Wales, Scotland, England, and Ireland. Most are made of stone, but wood was also used. Soil was also piled up to create banks, ditches, and circles. Many of these structures are of archaeological interest and are found throughout the countries. The builders Prehistoric people Carbon dating shows that it was built in five phases from 3500 ­ 1520 BC Class Question H...

Keeled → Inglise keel
18 allalaadimist
Inglise keele riigieksami kirjutamise spikker- suur kokkuvõte
8
doc

Inglise keele riigieksami kirjutamise spikker / suur kokkuvõte

Riigieksami teiseks ülesandeks on kas essee või aruandekirjutamine; nõutud pikkuseks on 200 (+/- 10%) sõna. Esseed ja aruannet hinnatakse neljast kriteeriumist lähtuvalt: ülesandetäitmise täpsus, teksti korrasta tus, sõnavara ja grammatika. Essee (Essay) teemad on õppekava teemade põhjal sõnastatudarvamused või väited, mis puudutavad kaasaegset maailma janõuavad seisukohavõtmist antud küsimuses. Essee pi kkus onneli kuni viis lõiku. Esimene lõik moodustab sissejuhatuse, kusesimene lause peak s tõmbama lugeja tähelepanu (hook) ningpaar järgmist lauset peaksid viima sealt essee p õhiväiteni (thesis statement). Kaks kuni kolm lõiku peaksid nüüd põhiväidetavama. Igas lõigus esitatakse esi meses lauses väide (topic sentence) ja tõestatakse/toetatakse seda siis näidete, arvude võitsitaadiga (supporting evidence). Oluline on, et igas lõigusräägitakse ainult ühel teemal, ega hüpata ühelt argum endiltteisele. Viimane lõik moodustab kokkuvõtte ...

Keeled → Inglise keel
175 allalaadimist
English Grammar Book 1
159
pdf

English Grammar Book 1

Book 1 BASIC ENGLISH BASIC ENGLISH GRAMMAR GRAMMAR BASIC ENGLISH GRAMMAR Book 1 Book 1 Younger students at beginning to intermediate levels will greatly benefit from this step-by-step approach to English grammar basics. This is the ideal supplement to your language arts program whether your students are native English speakers or beginning English language learners. Skill-specific lessons make it easy to locate and prescribe instant reinforc...

Keeled → Inglise keel
193 allalaadimist
Estonian Court System
4
doc

Estonian Court System

Estonian Court System Estonia has a three-level court system. Estonian court system consists of four country courts, two administrative courts, three circuit courts and supreme court. Country courts and administrative courts are the courts of first instance, circuit courts are courts of appeal and the supreme court, situated in Tartu, is the court of the highest instance The Supreme Court is also the constitutional review court. In the structure of four country courts(Harju, Pärnu, Tartu and Viru) operate courthouses in every country seat(in Ida- Virumaa and Harjumaa there are three courthouses)In the structure of two administrative courts(in Tallinn and Tartu) there are four courthouses: in Tallinn, Tartu, Jõhvi and Pärnu. Three circuit courts are situated in Tallinn, Tartu and Jõhvi. The supreme court The Supreme Court is the court of the highest instance, which shall review decisions by way of cassation proceedi...

Keeled → Inglise keel
23 allalaadimist
Letters
38
doc

Letters

Letters Letters FORMAL, INFORMAL, TRANSACTIONAL TASK 1 Read the extracts and answer the questions. · Where are the extracts from? · What is the purpose of each letter? · How do they differ? · Which extracts are examples of formal letters? · How is the reader addressed in a formal letter? · What are the closing remarks for formal letters? · What is the salutation in a friendly letter? · How would you end extracts 1,2,3 ? · How would you begin the extracts 4 and 5? 1. Dear Mr Miller, I received your kind invitation to the reception. Unfortunately, owing to other commitments. I will be unable to attend ... 2. Dear Ralph, l just got your invitation to the company's event. l `m afraid I can't make it because I've a/ready made plans which l can "t change ... 3. Dear Sirs, I am writing to complain about the poor quality of ...

Keeled → Inglise keel
32 allalaadimist
Ssubtiitrite lugemiskiirus
17
pdf

Ssubtiitrite lugemiskiirus

Seediscussions,stats,andauthorprofilesforthispublicationat:https://www.researchgate.net/publication/280905030 Subtitlereadingspeed:Anewtoolforits estimation ArticleinBabel·January2014 DOI:10.1075/babel.59.4.02mar CITATIONS READS 3 179 1author: JoséLuisMartíFerriol UniversitatJaumeI 13PUBLICATIONS18CITATIONS SEEPROFILE Someoftheauthorsofthispublicationarealsoworkingontheserelatedprojects: Inclusiónsocial,traducciónaudiovisualycomunicaciónaudiovisual(ÍTACA)Viewproject AllcontentfollowingthispagewasuploadedbyJoséLuisMartíFerriolon13October2017. Theuserhasrequestedenhancementofthedownloadedfile. John Benjamins Publishing Company This is a contribution from Babel 59 : 4 © 2013. All rights reserved. This electronic file may not be altered in any w...

Varia → Sissejuhatus erialaõppesse
1 allalaadimist
CPM1A Programmable Controllers Operation Manual 1784470
402
pdf

CPM1A Programmable Controllers Operation Manual 1784470

Cat. No. W317-E1-11 SYSMAC CPM1A Programmable Controllers OPERATION MANUAL CPM1A Programmable Controllers Operation Manual Revised October 2007 iv Notice: OMRON products are manufactured for use according to proper procedures by a qualified operator and only for the purposes described in this manual. The following conventions are used to indicate and classify precautions in this manual. Always heed the information provided with them. Failure to heed precautions can result in injury to people or dam- age to property. ! DANGER Indicates an imminently hazardous situation which, if not avoided, will result in death or serious injury. Additionally, there may be severe property damage. ! WARNING Indicates a potentially hazardous situation which, if not avoided, could re...

Tehnika → Automatiseerimistehnika
9 allalaadimist
Proseminar
8
doc

Proseminar

FGI 1811 Proseminar (Irina Ladusseva) 2.0 AP Kab. 420 03.09.2002. Writing a term paper (this spring) and graduation paper. To get a pass: one written task (part of introduction, thesis statement) Term paper should be printed (20-25 pages long). Graduation paper should be printed (50-60 pages long). First write term paper, and choose a topic right now (theme of term paper later will be developed into graduation paper). Rights: we have a right to have a supervisor. Supervisor writes on the front page "Lubatud kaitsmisele". You need time to: 1. read the theory 2. collect material 3. regularity (1-2 hours a day deal with your paper) The first draft of term paper should be ready by March. Supervisors are: 1. Suliko Liiv (country study, grammar, contrastive studies, methodology) 2. Liliana Skopinskaja (methodology) 3. Jaanika Marley (foneetika, methods) 4. Ene Alas (translation, meth...

Õigus → Proseminar
36 allalaadimist
Raamatu ajalugu - kokkuvõte
15
doc

Raamatu ajalugu - kokkuvõte

BOOKS (From Wikipedia, the free encyclopedia) A book is a set or collection of written, printed, illustrated, or blank sheets, made of paper, parchment, or other various material, usually fastened together to hinge at one side. A single sheet within a book is called a leaf, and each side of a leaf is called a page. A book produced in electronic format is known as an electronic book (e-book). Books may also refer to works of literature, or a main division of such a work. In library and information science, a book is called a monograph, to distinguish it from serial periodicals such as magazines, journals or newspaper. The body of all written works including books is literature. In novels and sometimes other types of books (e.g. biographies), a book may be divided into several large sections, also called books (Book 1, Book 2, Book 3, etc.). A lover of books is usually referred to as a bibliophile, or, more informally, a bookworm. A st...

Keeled → Inglise keel_baaskursus
23 allalaadimist
English as a Global Language
60
pdf

English as a Global Language

Tallinna Mustamäe Humanitargümnaasium Valeria Jefremenkova ENGLISH AS A GLOBAL LANGUAGE INGLISE KEEL KUI ÜLEMAAILMNE KEEL Research work Supervisor: Jevgenija Kozlova Tallinn 2016 1 Table of Contents СONTENT…………………………………………………………………………………...2 INTRODUCTION…………………………………………………………………………...3 CHAPTER I……………………………………………………………………………….....5 1.1. A Brief History of the English Language…………………………………………...…..5 1.2. Origins of English as the Global Language……………………………………..……....6 1.3. Necessity of a Global Language...……………………………………………………....8 1.4. Criticism of a Global Language………………………………………………………....9 1.5. The Role of English Today……………………………………………………………..10 1.6. English Speaking Countries…………………………………………………………….11 1.7. Perspectives of English………………………………………………………………....13 CHAPTER I...

Keeled → Inglise keel
5 allalaadimist
Keelefilosoofia raamat
234
pdf

Keelefilosoofia raamat

Philosophy of Language Philosophy of Language: a Contemporary Introduction introduces the student to the main issues and theories in twentieth and twenty-first-century phi- losophy of language, focusing specifically on linguistic phenomena. Topics are structured in four parts in the book. Part I, Reference and Referring, includes topics such as Russell's Theory of Descriptions, Donnellan's distinction, problems of anaphora, the description theory of proper names, Searle's cluster theory, and the causal­historical theory. Part II, Theories of Meaning, surveys the competing theories of linguistic mean- ing and compares their various advantages and liabilities. Part III, Pragmatics and Speech Acts, introduces the basic concepts of linguistic pragmatics, includes a detailed discussion of the problem of indirect force and surveys approaches to metaphor. Part IV, new to this edition, examines the four theories of metaphor. Features...

Filosoofia → Filosoofia
48 allalaadimist
Aborigeenid-Inglise keeles
13
doc

Aborigeenid (Inglise keeles)

Miina Härma Gümnaasium “The aborigines of Australia Student:Kärt Erikson Teacher:Tiia Timma Tartu 2010 contents  Introduction – page 3  History – page 3-4  Religion – page 4-7  Society - page 7-9  The British – page 9-10  Conclusion – page 10-11  Resources – page 11  Appendix – page 11-14 2 Introduction I selected this theme because it was the most interesting one for me. Aborigines have interested me for a long time now so doing this essay is really fun for me. Australian Aboriginal culture is one of the world's longest surviving cultures. Australian Aborigines, also known as Indigenous Australians , are the native people of Australia . Many of them suffered when white people from Britain arrived in Austra...

Keeled → Geograafia inglise keeles
6 allalaadimist
ASPECTS OF BRITISH HISTORY
188
rtf

ASPECTS OF BRITISH HISTORY

N. A. Vavilov ASPECTS OF BRITISH HISTORY Н. А. Вавилов КРАТКАЯ ИСТОРИЯ ВЕЛИКОБРИТАНИИ Учебное пособие на английском языке Москва Институт международного права и экономики имени А. С. Грибоедова 2008 2 УТВЕРЖДЕНО кафедрой лингвистики и переводоведения Вавилов Н.А. Краткая история Великобритании: Учебное пособие на английском языке. – 2-е изд., пересмотр. и испр. – М.: ИМПЭ им. А.С. Грибоедова, 2008. – 88 с. Пособие содержит краткий очерк важнейших событий в истории Великобритании – от первых документально засвидетельствованных вторжений на остров (кельтов, римлян и англосаксов) до создания и распада Британск...

Filoloogia → Vene filoloogia
3 allalaadimist
Estonia TEST english I
5
docx

(Estonia TEST english I)

Milestones in Estonian History The Estonians are a Finno-Ugric people who came from the area near the Urals and the Volga and Oka rivers. They migrated westward to the Baltic shores some 5, 000 years ago. In the ninth century A.D. Viking ships invaded Estonia and the country became a vital link in the sea-trade between East and West. By the 12th century, the Arabian geographer al-Idrisi had placed the city on his maps. In the 13th century, Tallinn joined the Hanseatic League, the union of European commercial towns that stretched from London to Novgorod. Pärnu, Viljandi and Tartu were also members. Estonia became a vital link in the sea-trade between East and West. The oldest preserved book written in Estonian, a catechism, dates from 1535. Tartu University was established in 1632, on orders from Sweden's King Gustav II Adolf. Literacy spread. The Bible was translated into Estonian in 1739(pole vaja teada). A period of wars began in...

Keeled → Inglise keel
90 allalaadimist
Sissejuhatus inglise õiguskeelde
35
docx

Sissejuhatus inglise õiguskeelde

11.02.09 INGLISE KEEL Palju aega läheb. 10 nädalat aint. One of the ESP courses. What we are going to do, what is needed: · What we do - 1 test, on words. · 2 Essays, that means that we have to look into academic writing · Homereading ­ we read a case from European Court of Justice thingy. · Oral thing. · 90% you have to attend · Have to prepare for class and take part of it etc What we learn: Terms Expressions / collocations (nt obey/abide by the law) Explaining AWOL ­ absence without a leave Legal English can be divided into 3 levels. We learn the first one, which is needed for the other two! You have to know the vocabulary etc. Second level has to do with legal contracts... The third level both 1 and 2 and explaining... We learn the vocabulary + explaining. Process of law-making draft law/bill (seaduseelnõu) is developed draft is sent to the parl...

Keeled → Inglise õiguskeel 1
268 allalaadimist
Järjestuste võrdlemine-otsingud andmebaasidest-BLAST-FASTA-SW-
23
doc

Järjestuste võrdlemine, otsingud andmebaasidest (BLAST, FASTA, SW).

Bioinformaatika ülesanded Järjestuste võrdlemine, otsingud andmebaasidest (BLAST, FASTA, SW). 1. BLAST programmide kasutamine tundmatu valgujärjestuse identifitseerimiseks või sarnaste valgujärjestuste leidmiseks (http://www.ncbi.nlm.nih.gov/BLAST/). Programmide kasutamisel tutvuda tutorialite ja juhenditega!!! (http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/information3.html). a. Otsida sarnaseid järjestusi antud valgujärjestusele. Valida sobiv programm vastavalt NCBI juhendile valgujärjestuse võrdlemiseks valgujärjestuste seast. Valida otsimiseks Refseq andmebaas, sooritada otsing, tulemuste formaat 500 joondamise jaoks. GTESPLLTDPSTPNFFWLAWQARDFMSKKYGQPVPDRAVSLAINSRTGRTQNHFHIHISCIRPDVRKQLDNNLAN ISSRWLPLPGGLRGHEYLARRVTESELVQRSPFMMLAEEVPEAREHMGRYGLAMVRQSDNSFVLLATQRNLLTLN RASAEEIQDHQCEILRMRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEM...

Informaatika → Bioinformaatika
41 allalaadimist
Tartu ajalugu
5
doc

Tartu ajalugu

Sculptures and monuments St. John's Lutheran Church St John's Church was probably built in the first third of the 14th century. There is no other brick church decorated with so much terracotta plastic in Europe Eduard Tubin Monument The Eduard Tubin monument, marking the 100th birthday of the composer, was dedicated in 2005. The authors of the statue are sculptor Aili Vahtrapuu, architect Veronika Valk, with sound installations by Louis Dandrel.Eduard Tubin (1905-1982) was a versatile composer and conductor, one of the most recognized symphonists throughout history. He served as concert master and conductor at the Vanemuise Theatre. In 1944, when the theatre was destroyed, he left Estonia to Sweden. Monument to Gustav II Adolf In 1632, King Gustav II Adolf of Sweden, then at the war camp near Nürnburg, signed the charter to found Tartu University, which was also named Academia Gustaviana in his honour....

Keeled → Inglise keel
26 allalaadimist
CHANGE YOUR THINKING CHANGE YOUR LIFE
580
pdf

CHANGE YOUR THINKING CHANGE YOUR LIFE

ccc_tracy_fm_i-xviii.qxd 7/7/03 3:22 PM Page iii CHANGE YOUR THINKING, CHANGE YOUR LIFE How to Unlock Your Full Potential for Success and Achievement B R I A N T R AC Y JOHN WILEY & SONS, INC. ccc_tracy_fm_i-xviii.qxd 7/7/03 3:22 PM Page i CHANGE YOUR THINKING, CHANGE YOUR LIFE ccc_tracy_fm_i-xviii.qxd 7/7/03 3:22 PM Page ii ccc_tracy_fm_i-xviii.qxd 7/7/03 3:22 PM Page iii CHANGE YOUR THINKING, CHANGE YOUR LIFE How to Unlock Your Full Potential for Success and Achievement B R I A N T R AC Y JOHN WILEY & SONS, INC. ccc_tracy_fm_i-xviii.qxd 7/7/03 3:22 PM Page iv ...

Keeled → Inglise keel
19 allalaadimist
Eesti referaat
8
doc

Eesti referaat

Tallinna Inglise Kolledz Estonia Topic Alice Tärk, 9b Tallinn 2007 FACTFILE Area: 45 228 sq km Poplulation: under 1.4 million Capital: Tallinn Language: Estonian Currency: Eesti kroon (EEK) Main religion: Lutheran National holiday: 24 February (anniversary of the republic) National flower: Cornflower National bird: Barn Swallow National stone: Limestone LOCATION The Republic of Estonia is the northernmost and smallest of the three Baltic States. It is located on the eastern shores of the Baltic Sea in the north east of Europe. To the east the country borders Russia. Latvia is the countries neighbour to the south. From the west the coast of Estonia is washed by the Baltic Sea and from the north by the Gulf of Finland. The length of the coastline is approximately 3 800 km. The longest distance from east to west is 350 km, while nort...

Keeled → Inglise keel
175 allalaadimist
Suhted laste ja vanematega
21
pdf

Suhted laste ja vanematega

Maturita Solutions Upper-Intermediate Workbook Key Unit 1 2 members of the royal family, politicians, reality TV contestants, 4 1 2 had known had been waiting singers and TV presenters 3 had enjoyed/had been enjoying 1A Talking about people ...

Inimeseõpetus → Inimeseõpetus
18 allalaadimist
TheCodeBreakers
946
pdf

TheCodeBreakers

Some of the things you will learn in THE CODEBREAKERS • How secret Japanese messages were decoded in Washington hours before Pearl Harbor. • How German codebreakers helped usher in the Russian Revolution. • How John F. Kennedy escaped capture in the Pacific because the Japanese failed to solve a simple cipher. • How codebreaking determined a presidential election, convicted an underworld syndicate head, won the battle of Midway, led to cruel Allied defeats in North Africa, and broke up a vast Nazi spy ring. • How one American became the world's most famous codebreaker, and another became the world's greatest. • How codes and codebreakers operate today within the secret agencies of the U.S. and Russia. • And incredibly much more. "For many evenings of gripping reading, no better choice can be made than this book." —Christian Science Monitor THE ...

Informaatika → krüptograafia
15 allalaadimist
Automaatika referaat-eng
10
doc

Automaatika referaat (eng)

Tallinna Polütehnikum Automation Author: TomTom2 Group :AA-09 Instructor: Marina Zotikova Tallinn 2010 Contents Introduction......................................................................................................................3-4 Person Knowledge Technologies supports......................................................................4-6 Online Essay Evaluation Service.....................................................................................6-7 WordNet lexical database................................................................................................7-8 Practice Online (TPO)................................................................................................

Masinaehitus → Automaatika
19 allalaadimist
Lõpetatud ja lõpetamata tegusõnad vene keeles
25
docx

Lõpetatud ja lõpetamata tegusõnad vene keeles

Aspects are only used in the past and future tense. When you are talking in the present tense, you can ignore aspects all together. The aspects are: Imperfective - Incomplete, ongoing, habitual, reversed or repeated actions Perfective - Actions completed successfully. The perfective aspect is not created by changing the ending. There are normally two words for each verb. One is the imperfective, the other is the perfective. Often these two words are closely related, but this is not always the case. (Often the perfective is simply prefixed with “По”). ) Жить, Прожить – live Любить, Полюбить – love Делать, Сделать - do, make Говорить, Сказать - talk, speak, say. Работать, Поработать - work Aspects in the negative Using the negative with perfective verbs indicates the person failed to do that action. Using the imperfective will normally simply mean that it didn’t happen. Я не позвонила - I failed to phone (perfective) (but I was expecte...

Keeled → Vene keel
5 allalaadimist
Scotland
7
rtf

Scotland

Report of SCOTLAND Maiki Joakit 10. klass 2008 Etymology Scotland is from the Latin Scoti, the term applied to Gaels. The Late Latin word Scotia (land of the Gaels) was initially used to refer to Ireland. By the 11th century at the latest, Scotia was being used to refer to (Gaelic-speaking) Scotland north of the river Forth, alongside Albania or Albany, both derived from the Gaelic Alba. The use of the words Scots and Scotland to encompass all of what is now Scotland became common in the Late Middle Ages. History Repeated glaciations, which covered the entire land-mass of modern Scotland, have destroyed any traces of human habitation that may have existed before the Mesolithic period. It is believed that the first post-glacial groups of hunter-gatherers arrived in Scotland around 12,800 years ago, as the ice sheet retreated after the last glaciation. Groups of settlers began building the first known permanen...

Kategooriata → Uurimistöö
18 allalaadimist
Tuuma energia
13
odt

Tuuma energia

Tartus secondary school of business Nuclear Power Helena Nulk form 11b Tartu 2009 Table of contents Introduction..........................................................................................................................................3 What is nuclear power?....................................................................................................................3 Nuclear life cycle.............................................................................................................................3 What is nuclear energy?...................................................................................................................3 What is nuclear fusion?....................................................................................................................4 What is ...

Füüsika → Füüsika
22 allalaadimist
Sotsiaalpsühholoogia konspekt 2016
69
odt

Sotsiaalpsühholoogia konspekt 2016

Sotsiaalpsühholoogia 1. SP kui teadus SP ­ osa psühholoogiateadusest. SP maastik: eneseteadvus ja identiteet, sotsiaalne taju ja hoiakud, inimestevahelised suhted ja sotsiaalne mõju, suhtlemine, grupid ja grupiprotsessid ... Gordon Allport (1954): "Social psychology is an attempt to understand and explain how the thoughts, feelings, and behaviors of individuals are influenced by the actual, imagined or implied presence of other human beings". Tänapäeval: "SP is the study of the causes and concequences of interpersonal behaviour" (Schachter, Gilbert, Wegner, 2012) SR = inimestevaheliste suhete ruum - seaduspärasused, seletused, mõõtmine, sekkumine ... Populaarne SP: sõprade leidmine ja suhete hoidmine, mõjutamine, juhtimine ja eestvedamine, suhtlemisõpetused, üksindus ja üksildus ... Teaduslik ja tarbepsühholoogia. Meie - lai pilt SP-st - alus k...

Psühholoogia → Sotsiaalpsühholoogia
41 allalaadimist
William Shakespeare - Hamlet
406
pdf

William Shakespeare - Hamlet

Hamlet Shakespeare, William Published: 1599 Categorie(s): Fiction, Drama Source: Feedbooks 1 About Shakespeare: William Shakespeare (baptised 26 April 1564 – died 23 April 1616) was an English poet and playwright, widely regarded as the greatest writer in the English language and the world's pre-eminent dramatist. He is often called England's national poet and the "Bard of Avon" (or simply "The Bard"). His surviv- ing works consist of 38 plays, 154 sonnets, two long narrative poems, and several other poems. His plays have been trans- lated into every major living language, and are performed more often than those of any other playwright. Shakespeare was born and raised in Stratford-upon-Avon. At the age of 18 he married Anne Hathaway, who bore him three children: Susanna, and twins Hamnet and Judith. Between 1585 and 1592 he began a successful c...

Keeled → Inglise keel
6 allalaadimist
The 4-Hour Body - An Uncommon Guide to Rapid Fat-Loss-Incredible Sex-and Becoming Superhuman - Timothy Ferriss
574
pdf

The 4-Hour Body - An Uncommon Guide to Rapid Fat-Loss, Incredible Sex, and Becoming Superhuman - Timothy Ferriss

PRAISE FOR The 4-Hour Workweek "This is a whole new ball game. Highly recommended." --Dr. Stewart D. Friedman, adviser to Jack Welch and former director of the Work/Life Integration Program at the Wharton School, University of Pennsylvania "It's about time this book was written. It is a long-overdue manifesto for the mobile lifestyle, and Tim Ferriss is the ideal ambassador. This will be huge." --Jack Can eld, cocreator of Chicken Soup for the Soul®, 100+ million copies sold "Stunning and amazing. From mini-retirements to outsourcing your life, it's all here. Whether you're a wage slave or a Fortune 500 CEO, this book will change your life!" --Phil Town, New York Times bestselling author of Rule #1 "The 4-Hour Workweek is a new way of solving a very old problem: just how can we work to live and prevent our lives from being all about work? A world of in nite...

Keeled → Inglise keel
20 allalaadimist
Mõtteterad
84
odt

Mõtteterad.

Kõige hullem viis kedagi igatseda on olla tema kõrval ja teada, et sa ei saa teda kunagi. Selle asemel, et igatseda vanu aegu, tuleks võtta kõik praegusdest aegadest, sest ka need muutuvad ajapikku vanadeks aegadeks ja siis on meil mida mäletada. Igatsus armsa sõbra vastu tunned alles siis, kui olete lahkunud. Vahepeal igatsen Sind nii palju, et mul hakkab paha. Inimesed, kes tõeliselt igatsevad on hoopiski teistsugused, nemad ei ütle välja seda, just nemad istuvad keskööni üleval, just need püüavad sõprade juures naerda, käivad mälestustemaal ning tänu sellele on igatsus nii tohutult valus neile! Igatsen sind hoolimata sellest, et sa murdsid igaveseks mu südame. Igatsedes ei suuda olla Mina ise, pole isu, ei maga, ei taha midagi... nagu oleks haigus keha vallutanud. Keegi ei saa minna tagasi ja alustada uuesti algusest, kuid igaüks saab alustada täna ja teha uue lõpu. Mäletad, kuidas sa naeratasid mulle esimest korda? Mina istu...

Kirjandus → Kirjandus
137 allalaadimist
Anthropology and Tourism
24
docx

Anthropology and Tourism

Anthropology of Tourism Madli Tuvike Anthropology and Tourism Female Adventure Tourism This essay will explain what significance culture has in adventure tourism. There are five paragraphs in this essay, where definitions of adventure travel and human culture are given. First, paragraph will look and define what culture, anthropology and adventure tourism are. Second paragraph will examine how different cultures impact female adventure travel. Third paragraph will point out the problems in adventure tourism. The forth paragraph will give recommendations for the future and some of the possible future problems in female adventure tourism will be looked at. The last paragraph will be a summary of the key findings and recommendations. Tourism is one of the world’s largest industries (Tisdell, 2000, Swarbrooke et al. 2003, Buckley, 2003). According to UNWTO, i...

Keeled → Ingliskeelsete maade ühiskond...
1 allalaadimist
Upstream intermediate b2 teacher s book
309
pdf

Upstream intermediate b2 teacher's book

;P ulJbijlg lsBN 978-1-8432s-569-7 Illllll]ililil]t llll ||||rl 9 x781843x255697x Conlenls UNI T1 househol d & appl i ances; dw el l i ngs ln Searchof the Perfect My Home is my chores;colours& rooms;home H ome(mul ti pl choi e ce) Castle(pp. 5-19) safety TheCharmingPast:Blarney ...

Keeled → Inglise keel
239 allalaadimist


Sellel veebilehel kasutatakse küpsiseid. Kasutamist jätkates nõustute küpsiste ja veebilehe üldtingimustega Nõustun