Vajad kellegagi rääkida?
Küsi julgelt abi LasteAbi
Logi sisse
Sulge

KETTLE - sarnased materjalid

Leidsid 33 sarnast õppematerjali, mis on seotud failiga "KETTLE". Need materjalid aitavad sul teemat sügavamalt mõista.

easy, fast, slip, fleet, automatic
Ford escorti käsiraamat
256
pdf

Ford escorti käsiraamat

. . . . . . . . . .8 Turbocharger-to-manifold nut check - RS Turbo models . . . . . . . .23 Fluid level checks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3 Tyre checks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4 Front brake disc pad check . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .16 Valve clearance adjustment - OHV and HCS engines . . . . . . . . . . .21 Degrees of difficulty Easy, suitable for Fairly easy, suitable Fairly difficult, suitable Difficult, suitable for Very difficult, novice with little for beginner with for competent DIY experienced DIY suitable for expert DIY

Auto õpetus
107 allalaadimist
Stretches and exercises in office
8
ppt

Stretches and exercises in office

2. Take several deep breathes and take in the complete darkness (or visualize a relaxing setting); 3. After 20 seconds or so, uncover your eyes and allow them to refocus. You're ready to continue your day! Meditation: Meditation is very helpful, especially when you need to relieve some stress or rest after stretches. Sit on your chair with your spine straight and both feet flat on the floor. Start taking long, deeply breaths and then gently slip your chin down to your chest. Resting your hands on your thighs or down by your side, relax your shoulders down and back. Close your eyes and take your gaze to a point between your eyebrows. Take 5 to 10 long deep breaths, shut eyes focused between your brows. Used Referencies: · http://www.ccohs.ca/oshanswers/ergonomics/office/stretching.html · http://exercise.about.com/cs/exerciseworkouts/l/blofficeworkout.htm · http://www.healthservices.uwaterloo.ca/occupationalhealth/ergonomic

Ergonoomika
32 allalaadimist
FCE Result Words and Phrases
64
doc

FCE Result Words and Phrases

struggle (v) stubborn (adj) stuff (n) stunt (n) subjective (adj) submit (v) substance (n) subtract (v) suffer (v) sufficient (adj) suit you down to the ground (phr) sum up (v) summon (v) summon the nerve (phr) supply (n) supply depot (n) suppress (v) surgeon (n) surreal (adj) surrounded by (adj) surroundings (n pl) surveillance (n unc) survival (n) suspect (n) swallow (v) swan (n) swap (v) swear (v) sweaty (adj) swell (v) swerve (v) swift (adj) symbol (n) sympathetically (adv) tactic (n) take it easy (phr) take it for granted (phr) take place (phr) take sb up on (v) take sth for granted (idm) take the blame for (phr) take your mind off something (idm) talent (n) talk back (phr v) 28 talk show (n) tank (n) tanned (adj) tap (n) tap (v) target (n) taste for (n) tasteless (adj) team player (n) telegraph wire (n) telepathic (adj) temporary (adj) tend (v) tender (adj) tense (adj) terminal building (n) terrain (n) testify (v) texture (n) theft (n) theme (n)

Inglise keel
2 allalaadimist
Videvik kogu raamat Inglise keeles
274
docx

Videvik(kogu raamat Inglise keeles)

I was expected, a topic of gossip no doubt. Daughter of the Chief's flighty ex-wife, come home at last. "Of course," she said. She dug through a precariously stacked pile of documents on her desk till she found the ones she was looking for. "I have your schedule right here, and a map of the school." She brought several sheets to the counter to show roe. She went through my classes for me, highlighting the best route to each on the map, and gave me a slip to have each teacher sign, which I was to bring back at the end of the day. She smiled at me and hoped, like Charlie, that I would like it here in Forks. I smiled back as convincingly as I could. When I went back out to my truck, other students were starting to arrive. I drove around the school, following the line of traffic. I was glad to see that most of the cars were older like mine, nothing flashy. At

Kirjandus
19 allalaadimist
Tööstuslik andmeside kontrolltöö 2 abimaterjal - vastused
3
doc

Tööstuslik andmeside kontrolltöö 2 abimaterjal - vastused

Supervisory format - S frame · handle compression and encryption at lowest possible layer ­ Basic TCP/IP protocol would be comparable to a cell. · sampled signal is either high (1) or low (0) "S" frames are used for error control (to acknowledge frames or · easy authentication at other end of connection network of city streets. -> shifted into SIPO request for retransmissions) or flow control (to ask for Two precise definitions of "point-to-point" in the context of ­ Streets can serve many access points.

Tööstuslik andmeside
31 allalaadimist
TOPICS FOR SPEAKING
28
doc

TOPICS FOR SPEAKING

TOPICS FOR SPEAKING CYLINDER FRAME The cylinder section of the engine consists of a number of cylinder blocks, which are tightened together with the engine frame and the bedplate by means of through- going stay bolts. Two central bores, one at the top and one halfway down inside the cylinder block, enclose the cylinder liner. The upper part of the cylinder block forms part of the cooling water space around the central part of the cylinder liner, whereas the lower part forms the scavenge air space. A central bore in the bottom of the cylinder block encloses the piston rod stuffing box. The bottom is double with a hollow space through which cooling water is circulated. On the exhaust side of the cylinder block there is a circular opening leading into the longitudinal scavenge air receiver of the engine. Furthermore, there is an inlet pipe for cooling and lubricating oil. The cylinder block is provided with cleaning and inspection covers for the cooling water and

Inglise keel
9 allalaadimist
Vormistamine ülesanne 2
20
docx

Vormistamine ülesanne 2

roughly spherical masses made of entangled fibers. Mainly caused by the abrasion of fabric surface occurring during washing and wearing of fabrics, this defect needs to be accurately controlled and measured by companies working in the textile industry. Pilling measurement is traditionally performed using manual procedures involving visual control of fabric surface by human experts. Since the early nineties, great efforts in developing automatic and non-intrusive methods for pilling measurement have been made all around the world with the final aim of overcoming traditional, visual-based and subjective, procedures. Machine Vision proved to be among the best options to perform such defect assessment since it provided increasingly performing measurement equipment and tools, serving the purpose of automatic control. In particular, a relevant number of interesting

Andme-ja tekstitöötlus
2 allalaadimist
Lühendite seletus
120
doc

Lühendite seletus

A... AA Auto Answer AAA Authentication, Authorization and Accounting AAB All-to-All Broadcast AAC Advanced Audio Coding AACS Advanced Access Control System AAL Asynchronous Transfer Mode Adaption Layer AAM Automatic Acoustic Management AAP Applications Access Point [DEC] AARP AppleTalk Address Resolution Protocol AAS All-to-All Scatter AASP ASCII Asynchronous Support Package AAT Average Access Time AATP Authorized Academic Training Program [Microsoft] .ABA Address Book Archive (file name extension) [Palm] ABAP Advanced Business Application Programming [SAP] ABC * Atanasoff-Berry Computer (First digital calculating machine that used vacuum tubes) ABEND Abnormal End

Informaatika
117 allalaadimist
Unit 4 HEALTH AND CARE
2
pdf

Unit 4 HEALTH AND CARE

Unit 4 HEALTH AND CARE 17.conventional medicine n - the usual form of medicine Language Leader Advanced practised in most European and North American countries [= western medicine] tavameditsiin 1. alternative medicine ['meds()n] n - medical 18.cough v - [kf] to suddenly push air out of your throat treatment that is not based on the usual western with a short sound, often repeatedly: Matthew methods: Acupuncture is widely used by practitioners coughed and cleared his throat. köhima of alternative medicine. 19.discharge v - to officially allow someone to leave 2. anonymous ['nnims] adj - unknown by name: Our somewhere, especially the hospital or the army, navy client prefers to remain anonymous. etc, or to tell them that they mu

Inglise keel
3 allalaadimist
Dey Bared to You RuLit Net
163
rtf

Dey Bared to You RuLit Net

gorgeous on any day of his life. I might have resented that if he hadn't been the dearest person on earth to me. "I'm not talking about a bender," he insisted. "Just a glass of wine or two. We can hit a happy hour and be in by eight." "I don't know if I'll make it back in time." I gestured at my yoga pants and fitted workout tank. "After I time the walk to work, I'm going to hit the gym." "Walk fast, work out faster." Cary's perfectly executed arched brow made me laugh. I fully expected his million-dollar face to appear on billboards and fashion magazines all over the world one day. No matter his expression, he was a knockout. "How about tomorrow after work?" I offered as a substitute. "If I make it through the day, that'll be worth celebrating." "Deal. I'm breaking in the new kitchen for dinner." "Uh..." Cooking was one of Cary's joys, but it wasn't one of his talents

Inglise teaduskeel
15 allalaadimist
PETROLEUM
29
rtf

PETROLEUM

and bitumen, and use more complex and expensive methods to produce the products required. Because heavier crude oils have too much carbon and not enough hydrogen, these processes generally involve removing carbon from or adding hydrogen to the molecules, and using fluid catalytic cracking to convert the longer, more complex molecules in the oil to the shorter, simpler ones in the fuels. Due to its high energy density, easy transportability and relative abundance, oil has become the world's most important source of energy since the mid-1950s. Petroleum is also the raw material for many chemical products, including pharmaceuticals, solvents, fertilizers, pesticides, and plastics; the 16 per cent not used for energy production is converted into these other materials. Petroleum is found in porous rock formations in the upper strata of some areas of the Earth's crust. There is also petroleum in oil sands (tar sands)

Inglise keel
4 allalaadimist
Piletid vastustega
13
docx

Piletid vastustega

2, 3, 4)Varactor. Zener. Bi-directional.Sch.Led. Photodiode. 5)Varactor: U=1-100V, C=10-100 microF. Zener: Zener=-2.4...-200V. Schottky: on state voltage drop=0.3V. LED: conducting current=2-10mA.Voltage drop=2-3V. 6)Varactor: +(higher reverse voltage, smaller capacitance) Bi-direct:+(it operates in either direction to monitr under-voltage dips and over-voltage spikes of the ac input) Schottky:+ (high frequency, very fast) ­(Very low breakdown) LED:+(Low voltage, long life, fast switching) 7)Zener:designed to operate in the reverse breakdown. They are backbone of voltage regulators.Bi-directional:Used for line filtering. Two Zener diodes connected back-to-back. It is used as a filtering device to protect voltage-sensitive electronic devices from high-energy voltage transients.Schottky: High frequency diode. Based on the fact, that electrons in different materials have different absolute potential energies and the potential energy of

Elektroonika jõupooljuht...
160 allalaadimist
Inglise keele majandussõnastik
13
docx

Inglise keele majandussõnastik

................................................lähenemisviis 48. Arbitrage ­ ..........................................................vahendustegevus 49. Arrangement ­ ....................................................korraldus 50. Asset ­ ................................................................vara 51. At a low cost per exposure ­ ...............................madal hind ühe avaldamise kohta 52. At the outset ­ .....................................................alguses 53. Automatic stabilizers ­ .......................................automaatsed stabilisaatorid 54. Awareness ­ ........................................................teadlikkus 55. Average ­ ............................................................keskväärtus 56. Average cost ­ .....................................................keskmine kulu 57. Average product ­ ...............................................keskmine produkt 58. Average total cost ­............................................

Inglise keel
71 allalaadimist
English Grammar Book 1
159
pdf

English Grammar Book 1

BASIC ENGLISH GRAMMAR Book 1 Book 1 Younger students at beginning to intermediate levels will greatly benefit from this step-by-step approach to English grammar basics. This is the ideal supplement to your language arts program whether your students are native English speakers or beginning English language learners. Skill-specific lessons make it easy to locate and prescribe instant reinforcement or intervention. · Illustrated lessons are tightly focused on core concepts of grammar · Nearly 70 practice exercises are included for ready reinforcement · A wealth of examples are provided on every topic · Concise explanations are bolstered by extra grammar tips and useful language notes Book 1 Anne Seaton · Y. H. Mew Three Watson

Inglise keel
193 allalaadimist
Formaldehyde
11
doc

Formaldehyde

Airborne concentrations are low comparing to limits > risk is low Indoor concentrations could be ten times the limit depending on the factors described above > risk is high Occupational exposure: as measurements showed exposure range is below limits, however there is always the risk to be exposed to formaldehyde vapor or gas because of its volatility > risk is moderate Risk for the environment As descried in environmental fate section formaldehyde is removed from the atmosphere quite fast. The fate of formaldehyde in soil has not been determined. The main target in the environment for formaldehyde is water. Taking into account that PNECaqua has low limit the risk is moderate for aquatic ecosystem. List of literature: http://www.atsdr.cdc.gov/ToxProfiles/tp111.pdf http://www.inchem.org/documents/sids/sids/FORMALDEHYDE.pdf http://www.cancer.gov/cancertopics/factsheet/Risk/formaldehyde http://monographs.iarc.fr/ENG/Monographs/vol88/index.php

Inglise keel
4 allalaadimist
Merepraktika aruanne-Praktikakoht Victoria I
78
pdf

Merepraktika aruanne: Praktikakoht Victoria I

EESTI MEREAKADEEMIA Laevandusteaduskond TÜÜRIMEES MEREPRAKTIKA ARUANNE Victoria I Praktikakoht 24.04.2007 ­ 23.04.2009 Praktika algus ja lõpp Õppegrupp: LL- 41 Juhendas: Rein Raudsalu TALLINN 2009 Retsensioonid 2 Sisukord LAEVA ANDMED, VAHITEENISTUS, LASTIKÄSITLUS, PÜSTUVUS, MEREPRAKTIKA .........................................................................................................................................................5 Üldandmed ..................................................................................................................................5 Joonised .......................................................................................................................................7 Vahitüürimehe vastutus navigatsioonivahis .........................................................................

Merepraktika
311 allalaadimist
Kama Sutra
25
docx

Kama Sutra

bent. Her partner slides in between her legs and lifts her hips slightly for easier penetration. He lifts her stomach up to his lips to caress and kiss. The Seated Ball The woman crouches, while the man enters her from a half-sitting position behind her. She controls the movement by rocking slowly on her heels, while the man kisses her back. The Curled Angel The woman curls up on her side, knees drawn up and the man spoons her from behind. Penetration is fairly easy from his position and the man can reach around to play with her breasts or clit. The Cross The woman lies on her back, one leg extended, the other bent up in the Cross sex position. The man sits down with one thigh over her extended thigh and slips her bent leg under his arm. The Perch The man sits on a chair with his partner on his lap, with her back to him. She uses the strength in her legs to make an up-and-down movement, while he caresses her clitoris and breasts. She may

2 allalaadimist
TheCodeBreakers
946
pdf

TheCodeBreakers

Mauborgne had long been interested in cryptology. In 1914, as a young first lieutenant, he achieved the first recorded solution of a cipher known as the Playfair, then used by the British as their field cipher. He described his technique in a 19-page pamphlet that was the first publication on cryptology issued by the United States government. In World War I, he put together several cryptographic elements to create the only theoretically unbreakable cipher, and promoted the first automatic cipher machine, with which the unbreakable cipher was associated. When he became head of the Signal Corps, he immediately set about augmenting the important cryptanalytic activities. He established the S.I.S. as an independent division reporting directly to him, enlarged its functions, set up branches, started correspondence courses, added intercept facilities, increased its budget, and put on more men. In 1939, when war broke out in Europe, S.I.S. was the first agency in the War

krüptograafia
15 allalaadimist
Järjestuste võrdlemine-otsingud andmebaasidest-BLAST-FASTA-SW-
23
doc

Järjestuste võrdlemine, otsingud andmebaasidest (BLAST, FASTA, SW).

Bioinformaatika ülesanded Järjestuste võrdlemine, otsingud andmebaasidest (BLAST, FASTA, SW). 1. BLAST programmide kasutamine tundmatu valgujärjestuse identifitseerimiseks või sarnaste valgujärjestuste leidmiseks (http://www.ncbi.nlm.nih.gov/BLAST/). Programmide kasutamisel tutvuda tutorialite ja juhenditega!!! (http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/information3.html). a. Otsida sarnaseid järjestusi antud valgujärjestusele. Valida sobiv programm vastavalt NCBI juhendile valgujärjestuse võrdlemiseks valgujärjestuste seast. Valida otsimiseks Refseq andmebaas, sooritada otsing, tulemuste formaat 500 joondamise jaoks. GTESPLLTDPSTPNFFWLAWQARDFMSKKYGQPVPDRAVSLAINSRTGRTQNHFHIHISCIRPDVRKQLDNNLAN ISSRWLPLPGGLRGHEYLARRVTESELVQRSPFMMLAEEVPEAREHMGRYGLAMVRQSDNSFVLLATQRNLLTLN RASAEEIQDHQCEILRMRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHI MLGAQNVDLNLSGAFTGETSAAML

Bioinformaatika
41 allalaadimist
The 4-Hour Body - An Uncommon Guide to Rapid Fat-Loss-Incredible Sex-and Becoming Superhuman - Timothy Ferriss
574
pdf

The 4-Hour Body - An Uncommon Guide to Rapid Fat-Loss, Incredible Sex, and Becoming Superhuman - Timothy Ferriss

last two years, and I've tracked and graphed hundreds of their results (194 people in this book). Many have lost more than 20 pounds of fat in the rst month of experimentation, and for the vast majority, it's the first time they've ever been able to do so. Why do 4HB approaches work where others fail? Because the changes are either small or simple, and often both. There is zero room for misunderstanding, and visible results compel you to continue. If results are fast and misunderstanding, and visible results compel you to continue. If results are fast and measurable,2 self-discipline isn't needed. I can give you every popular diet in four lines. Ready? · Eat more greens. · Eat less saturated fat. · Exercise more and burn more calories. · Eat more omega-3 fatty acids. We won't be covering any of this. Not because it doesn't work--it does ... up to a point. But

Inglise keel
20 allalaadimist
Leksikoloogia konspekt-uus
20
doc

Leksikoloogia konspekt (uus)

polloi, kerygma, lalophobia, magma, osteoporosis, phenomenon, photon, rhinoceros, rhododendron, stigma, synthesis, thesis.  With Latin endings o Brontosaurus, chrysanthemum, diplodocus, hippopotamus, Pliohippus  Endings dropped or adapted o Agnostic, agnosticism, alphabet, alphabetic, analyst, analytic, anthocyanin, astrobleme, atheism, automatic, biologist, biology, blasphemy, charismatic, chemotherapy, chronobiology, cinematography, critic, criticism, dinosaur, dogmatic, dogmatism, dramatic, dramatist, electric, electronic, enigmatic, epistemic, epistemology, gene, genetic, herpetology, narcolepsy, odyssey, oligarchy, patriarch, phenomenology, photograph, pterodactyl, sympathomimetic.  Modern

Inglise keel
14 allalaadimist
IT Strateegia IT Ettevõttele
24
pdf

IT Strateegia IT Ettevõttele

SO4: Reliable employee base WO3: Unattractive and obscure web SO5: Attractive inspiring office space in the representation and interface of products very heart of the city WO4: Too many areas of services SO6: WebMountain ­ the core for efficient WO5: Absence of real international business and easy building of information systems network WO6: Outdated technological core of the product WO7: Absence of real inner organizational structure, clear chain of command

Informaatika
58 allalaadimist
Õigusalase inglise keele sõnad väljendid eesti keelse tõlkega-units 12-18
11
docx

Õigusalase inglise keele sõnad/väljendid eesti keelse tõlkega (units 12-18)

Units 12-18 1. system of pandects ­ pandektiline süsteem 2. general provisions ­ üldosa 3. law of property ­ asjaõigus 4. family law ­ perekonnaõigus 5. law of sucession ­ pärimisõigus 6. law of obligations ­ võlaõigus 7. General Part of the Civil Code Act ­ TsÜS 8. Law of Property Act ­ AÕS 9. Family Law Act ­ perekonnaseadus 10. Law of Succession Act ­ PäRS 11. Law of Obligations Act ­ VÕS 12. persons and transactions ­ isikud ja tehingud 13. natural persons 14. legal persons 15. passive legal capacity ­ õigusvõime 16. active legal capacity ­ (an ability to independently asume civil rights and incur civil obligations) ­ teovõime 17. live birth ­ elussünd 18. bequeath property ­ pärandama 19. mental state ­ vaimne seisund 20. restricted active legal capacity ­ piiratud teovõime 21. mental illness ­ vaimehaigus 22. mental disability ­ nõdrameelsus 23. mental disorder ­ psüühiline häire (sickness of the

Inglise keel
28 allalaadimist
Topic - Great Britain
5
doc

Topic - Great Britain

Grampians and Southern Uplands, where most of the largest cities and population are located. Much of Wales is also mountainous and in England the Pennine Range extends 224 kilometres. The rest of England tends to be quite bumpy, for not even the large plains of East Anglia are perfectly flat. In Ireland all the highland areas are around the edge, but there are no peaks that surpass the height of one kilometer. The rivers are quite short, the longest being the Severn and the Thames. Their easy navigability has made them an important part of the inland transport network. 5. Population With 57 million people, the UK ranks about fifteenth in the world in terms of population, with England being the most populous part, followed by Scotland, then Wales and finally Northern Ireland. The population increases very slowly and somewhere between the `70s and `80s actually fell. Although there are more male births than female, the male mortality rate is rather high. 6. Climate

Inglise keel
27 allalaadimist
Cialdini raamat
548
pdf

Cialdini raamat

Limited Numbers 200 Time Limits 207 Psychological Reactance 203 Adult Reactance: Love, Guns, and Suds 206 Censorship 210 Optimal Conditions 213 New Scarcity: Costlier Cookies and Civil Conflict 213 Competition for Scarce Resources: Foolish Fury 217 Defense 221 Summary 225 Study Questions 226 CHAPTER 8 Instant Influence: Primitive Consent for an Automatic Age 227 Primitive Automaticity 228 Modern Automaticity 230 Shortcuts Shall Be Sacred 231 Summary 233 Study Questions 234 References 235 Index 254 Credits 260 About the Author Robert B. Cialdini is Regents' Professor of Psychology at Arizona State University, where he has also been named Graduate Distinguished Research Professor. He received undergraduate, graduate, and post-

Psühholoogia
24 allalaadimist
Revision Questions
14
pdf

Revision Questions

the United States. Giving birth in El Paso (US side) would deliver their children a precious advantage: it would make them Americans. Any child born at Arnold's birth center would possess American citizenship, courtesy of the 14th Amendment, and with it the ability to cross freely back and forth. El Paso, with its large, willing, cash-paying clientele, made an ideal destination for students. Though heightened security has put an end to the easier days, it is relatively easy for a resident of Juárez to obtain a U.S. border-crossing card, which permits short trips for social visits or shopping, and there is nothing illegal about crossing while pregnant -- at least for now. While American nationality has always been a desirable asset in Juárez, it has become much more valuable -- sometimes a matter of life and death -- since the drug violence erupted in earnest three years ago. The children

Inglise keel
6 allalaadimist
Liha töötlemine
1168
pdf

Liha töötlemine

Handbook of Meat Processing Handbook of Meat Processing Fidel Toldrá EDITOR A John Wiley & Sons, Inc., Publication Edition first published 2010 © 2010 Blackwell Publishing Blackwell Publishing was acquired by John Wiley & Sons in February 2007. Blackwell’s publishing program has been merged with Wiley’s global Scientific, Technical, and Medical business to form Wiley-Blackwell. Editorial Office 2121 State Avenue, Ames, Iowa 50014-8300, USA For details of our global editorial offices, for customer services, and for information about how to apply for permission to reuse the copyright material in this book, please see our website at www.wiley.com/ wiley-blackwell. Authorization to photocopy items for internal or personal use, or the internal or personal use of specific clients, is granted by Blackwell Publishing, provided that the base fee is paid directly to the Copyright Clearance Center, 222 Rosewood Drive, Danvers, MA 01923. F

Inglise keel
22 allalaadimist
Superstar 1 tests
41
doc

Superstar 1 tests

1 intelligent a in a hurry to do things 2 stubborn b giving things to other people 3 shy c believing in yourself 4 popular d being very clever 5 pessimistic e not very good at talking to other people 6 friendly f wanting to know the answer to things 7 impatient g easy to talk to and nice 8 generous h not changing your mind easily 9 curious i thinking things are bad or are getting worse 10 confident j a lot of people like you and you have a lot of friends Marks: /10

Inglise keel
67 allalaadimist
äri-inglisekeel sõnad
15
doc

äri-inglisekeel sõnad

tulevane ostja - prospective customer käepidemed ja puidust suveniirid - handles and wooden souveniers see pole paha mõte, kuigi väga julge - it's not a bad idea, though a very bold one tehingut pakkuma - to propose a deal nad suhtuvad väga tõsiselt ärisse - they are very serious about the business millised on nende tingimused? - what are their terms? nad kutsusid meid kaubandusmessile - they invited us to the trade õigeaegselt - in good time sa olid kiire plaani teostamisel - to be fast with realizing a plan nad on tõsiselt meist huvitatud - to be seriously intrested in somebody sellega seoses - in connection with meie esimesed kõrgekvaliteetsed liistud - our first top-quality slats millist vastukaja nad saavad - what response they get järele mõeldes - on the second thoughts kriitikat taluma - to stand criticism kõik näivad olevat selle poolt - everybody seems to be in a favour see juba läheb - that's the spirit 41 potenstaalne toode - a potential product

Inglise keel
164 allalaadimist
Informaatika Valemid
29
xlsx

Informaatika Valemid

Ülesanne. Andmed ja valemid Tallinna Tehnikaülikool Informaatikainstituut Töö Andmed ja valemid Üliõpilane Õppemärkmik Õppejõud Õpperühm a valemid ülikool ituut EALB12 Sisestage paremal olevatesse lahtritesse oma matrikli viimane (a) ja eelviimane (b) number. Nende kaudu arvutub automaatselt y nr ja z nr. Nende viimane nr eelviimane numbrite järgi võtad allolevatest valemitest kaks varianti. Ülejäänud kustuta ära. a b c y nr z nr 9 8 7 2 3 Funktsioonide väärtused Variandid

Informaatika
35 allalaadimist
Railgun
17
docx

Railgun

The goal, according to Tom Beutner, head of Naval Air Warfare and Weapons for the ONR, is ten shots per minute at 32 megajoules. One way of looking at it is that a .22 bullet has 1,000 foot- pounds aka 1356(Nm) of force at the muzzle. A 32 megajoule railgun shot: 23,601,988 foot- pounds aka 3.200000e(plus)7(Nm). The existing railgun works by using extremely high electrical currents to generate magnetic fields capable of accelerating a projectile up to Mach 6, which is more than twice as fast as any other existing projectile. The range is 100 miles and it fires projectiles which destroy targets by smashing into them at hypersonic speeds. The delay of railguns being added to the Navy is because they're making it more durable due to the fact that the raw kinetic power unleashed in firing the railgun is rough on the weapon's parts. When the railgun was delivered to the Navy in 2009 it was said that a few shots could dislodge the conducting rails or even damage the barrel of the gun

Inglise keel
1 allalaadimist
Backpaking lifestyle
38
pdf

Backpaking lifestyle

This is a post-refereeing final draft. When citing, please refer to the published version: Cohen, S.A. (2011). Lifestyle travellers: Backpacking as a way of life. Annals of Tourism Research, 38(4), 1535-1555. DOI: 10.1016/j.annals.2011.02.002 LIFESTYLE TRAVELLERS: Backpacking as a way of life Scott A. Cohena Bournemouth University, United Kingdom a corresponding author: School of Tourism, Dorset House, Talbot Campus, Poole, Dorset, BH12 5BB, United Kingdom. Tel: +44 1202 961261 Fax: +44 1202 515707 Email: [email protected] ABSTRACT Scholarship on backpackers speculates some individuals may extend backpacking to a way of life. This article empirically explores this proposition using lifestyle consumption as its framing concept and conceptualises individuals who style their lives around the enduring practice of backpacking as ‘lifestyle travellers’. Ethnographic interviews with lifestyle travellers

Inglise keel
1 allalaadimist
Book Analog Interfacing to Embedded Microprocessors
568
pdf

Book Analog Interfacing to Embedded Microprocessors

Will this cause data to be lost? Language/Compiler If you plan to use an object-oriented language such as C++, what happens when the CPU has to do garbage collection on the memory? Will data be lost? Does choosing this approach mean you have to go from a 100 MHz processor to a 500 MHz processor just to keep the garbage collection interval short? Avoiding Excess Speed Choosing a bus architecture and a processor that is fast enough to do the job is important, but it can also be important to avoid too much speed. It may not seem obvious that you wouldn’t always want the fastest bus and the fastest microprocessor, but there are applications where that is exactly the case. There are two basic reasons for this: cost and EMC (electromagnetic compatibility). Cost The PC/104 standard defines mechanical and electrical characteristics of PC boards, optimized for embedded applications. PC/104 CPU boards come with

Mehhatroonika
11 allalaadimist


Sellel veebilehel kasutatakse küpsiseid. Kasutamist jätkates nõustute küpsiste ja veebilehe üldtingimustega Nõustun