Advantages and disadvantages of living in the countryside The first outstanding characteristic about the countryside is that it is beautiful and peaceful. The air is fresh and the surroundings green. This is because the countryside is free from pollution, land or noise pollution. Living in the countryside has a lot of advantages, but also many disadvantages. The places where people live affects greatly in their lifestyles and living places is one of the very basic needs for people. Firstly you are fit and you don't need to worry about your health condition, because in the countryside the air and water are so clean. Another additional advantage is that there aren't any huge blocks of flats, modern skyscrapers or bothersome traffic jams. Living in the country is slower. People don't need to hurry and have a lot of time. The living cost in a country side is much lesser than that of a city. Most important advantage of livi...
Eesti Hotelli- ja Turismikõrgkool Hotelliteenindus H11 Oksana Bazakova CULTURAL TOURISM 2011 MEDIA & MARKETING PLAN ANALYSIS Analüüs turundusest alustest Õpetaja: Kristi Leinus Tallinn 2012 CULTURAL TOURISM 2011 Media & Marketing plan analysis. The first thing I came to notice while reading the document was that the plan provides no summary, neither in the beginning nor in the end and lacks any clearly-defined structure that would allow the reader to analyze the ideas presented in the plan in a comfortable manner by gradually proceeding from section to section. A more thorough step by step analysis is provided below: 1. Missing Executive Summary The analyzed m...
The goals of education Education is very important part of our lives. A good education gives us opportunity for better life and career. The topic of this presentation is the goals of education. · The main thing is that education provides the opportunity for an individual to develop morally, physically and socially and that to the greatest extent of their abilities. · Also we gain knowledge on world affairs. That shows that we are interested of other countries and we like to know more about their history. · Education develops our responsibility. · Maybe the main goal of education is that it prepares us to be independent. At this stage I`d like to conclude that education is one of the most important thing in our life. We gain knowledge, develop responsibility, learn how to be independent. Only we are responsible of our own future.
How does technology can improve a business performance? Keys to successful business Great service Highly productive employees Things have to be organized Analyze performance Understand risks Be innovative Why to use technology? Innovations in technology can help to turn small local businesses into global businesses Technology brings businesses closer to customers Increases productivity Makes things easier Involves more potential customers Can analyze performance How to use technology? Good communication Use smartphones Connect employees virtually with the company Teleconferencing Create employee portals and team sites No matter with location Better reviews Bring businesses closer to customers Help via email Online chat How to use technology? Internet marketing Information...
05144023 Compare and contrast the `direct` perception theory of Gibson with the `constructivist` perception theory of Gregory. Which provides a better account of human perception? Sensation involves physical stimulation of the sense organs, while perception is the organisation and interpretation of incoming sensory information. The Gestalt theorists first identified many of the principles that dominate in human visual perception. As Dowell (1995) has observed: "To perceive seems effortless. To understand perception is nevertheless a great challenge" (cited in Gross, 2005, pp 244). This essay will look at Gregory's theory and Gibson's theory of visual perception whether one or the other offers a better explanation of human visual perception. According to top-down perceptual processing theorists, perception is the end result of an indirect process that involves making inferences about the ...
Samsara An hour and a half long movie, which at first seems to be my longest ninety minutes ever, hides some real beauty in it. The movie gives us an opportunity to see every side of our planet. It makes me want to go and see every part of it. Samsara is a kind of movie that, at first, makes you want to change the channel. However, it gets much better the longer you watch it. There is just so much to see. It makes us wonder how is it possible that something that breathtaking even exists. On the other hand, it might be a hard movie to watch for some people, because it is slow and just drags on in places. I am more than sure that there are some who would rather watch paint dry. In addition, there is no one talking in the movie. In conclusion, I would like to say that Samsara is undoubtedly an amazing movie when it comes to showing the planet we live on. However, it is not a movie for everyone. A l...
My Breakfast It is not a secret to anybody nowadays that our meals influence our health as well as our mood. Breakfast remains essential to a healthy lifestyle; it replenishes person's supply of glucose and provides other essential nutrients to keep your energy levels up throughout the day. That's why I consider breakfast to be the most important meal in the day as it is the first our meal in the morning and it can put us in good spirits for the whole day. Now I shall tell you about my own breakfast. In the morning I usually have porridge or corn flakes. Sometimes I start my breakfast with a cereal which is not cooked, it is something dry, ready to be eaten or muesli some grain or porridge which is not cooked with dried fruit, nuts and so on. I also like eating eggs (cooked in different ways). I don't practically eat butter; I prefer soft margarine made of vegetable fat, which is not heavy and creamy. I don't eat j...
Visions of a sustainable world Creating a shared vision of a sustainable and desirable future is the most critical task facing humanity today. This vision must be of a world that we all want, a world that provides permanent prosperity within the Earth’s biophysical constraints in a fair. At the centre of the idea of sustainability is an ethical imperative to pass on a undiminished future to our children. To bring our world toward sustainability — or any other goal — we need to take different kinds of steps, which require different kinds of knowledge, talent, skill, and work. Future will be sustainable when citizens are concerned enough about the environment that they want to make a difference. It will happen when diverse groups from industry, environment, schools, service clubs, business, governments & the public come together and work towards a common vision of sustainability for our communities - bal...
*Estonians conquered by the crusaders 1208 *Reformation 16th century establishments of new school, Estonians first book appeared in 1525 *Tartu University 1632 founded by King Gustavus II Adolphus, classical university, member of the Coimbra group *Abolition of serfdom 1816 *Song festival 1869 in Tartu, an organiser was J.V.Jannsen, 822 singers, men only *Declaration of independence 24th February 1918 *War of independence 1918-1920 during the Russian Civil War, resulted in a victory for Estonia *Deportation 1949 *Estonia becomes independent 20th August 1991 *Joining EU 1st May 2004 Language: Estonian language, belongs to the Balti-Finnic group of the Finno-Ugric languages, closely realted to Finnish and rather remotely to Hungarian; Latin alphabet with 32 letters , 5 of which occur only in foreign words, the phenomes include 9 vowels and 18 consonants; words are borrowed from Latin, Greek, English etc.; sinc...
Topic Entertainment & Media The first newspapers were probably handwritten newssheets that government posted in public places. The earliest known newssheet was probably the Acta Diurna (Daily Events). Which began in Rome in 59 B.C. It reported the proceedings of the Roman Senate and such news as births and deaths.The first printed newspaper was a Chinese circular called Dibao. It was printed from carved wooden blocks during the A.D. 700's. The first regular published printed newspaper in Europe was Avisa Relation oder Zeitung of Strasbourg, Germany (now France). It started in 1609. A weekly newssheet established in 1622 was the first printed newspaper in England. The ground work for mass communications in the 20th century was laid in the 19th century by two inventions, which allowed people to communicate by wire: the electric telegraph and the telephon...
The absolutely true diary of a part-time indian by Sherman Alexie is a book about a boy named Arnold Spirit aka Junior, who spends his time drawing cartoons and who has many medical problems, which means that he's the one people pick on. He's got only one friend, Rowdy, who is strong enough to defend him against any bullies. Junior lives in reservation, but one day he realizes that most people on the reservation are alcoholics. He decides he wants a better life for himself and registers at an all-white school in Reardan and since that when he moved in Rearden, Rowdy regarded him as a traitor. When he arrives, Junior finds that he is the only Indian there and the students treat Junior as an outcast as well. Junior fight to improve his social standing and he accomplishes this when he goes out for Reardan's basketball team. Junior surprises himself when he makes the varsity team and eventually even becomes a starting player. Junior's b...
FACTS Ex1. 1. Create 2. Tarnished 3. Improve 4. Change Ex1. 1. Retain 2. Gives 3. Stick to 4. Distorting 5. 5. Shed 6. Project Based on Ex2. 1. Stereotyped 2. New 3. Public 4. Staid and Ex2. 1. Useless 2. Interesting 3. Necessary 4. stuffy 5. Clean 6. Right Well- known 5. Hard 6. Disturbing Ex3. 1. Captured 2. Appear 3. Blot out 4. Ex3. 1. Of 2. In 3. For 4. Of 5. From 6. Despite Produces 5. Conjures up 6. Projected Ex4. 1. Get your facts right 2. Face the facts 3. IMPACT The facts of life 4. A statement of fact Ex1. 1. Have 2. Make 3. Minimise 4. Assess 5. FAILURE Felt 6. Lost Ex1. 1. Feel 2. Crticised 3. Ended in 4. Blame 5. Ex2. 1. Major 2. Detrimental 3. Lasting 4. Admit 6. Put... down to Immediate 5. N...
Positive sides of outdoor learning Essay "Tell me and I forget. Teach me and I remember. Involve me and I learn." Benjamin Franklin In the last few years outdoor education has become more and more popular worldwide and in Estonia too. While there are many definitions for outdoor education, I think the best way to describe it would be outdoor education is a form of education, when learning takes place somewhere else than a classroom and the subjects are not only about the environment and nature but also linked to the national curriculum. Outdoor education often takes place on a walk around the block, a visit to the cemetery or a local post office. It can happen at a city zoo, on a forest trail, or in a national park. These kinds of locations are conducive to first- hand experien...
This a little help they who play with Gameforge games, no fraud/there is not a ramp in him, not hack the side... The essence that Paypal we nag it. Your monthly premium may turn up with this little trick and maybe yet a little one other service what the pay part of the given game provides. So: The 1. As a step register onto PayPal side. On this link https://www.paypal.com/us/cgi-bin/webscr?cmd=_registration-run There will be a cell like this there: Your country or region let us put Ez in another place The one under it Your language leave it so on the factory setting. (U.S. English) Then vállasszuk who from among the 3 opportunities Personal Account -ot and push Get Startedre. ! On the appearing sheet got now much kitlteni truth data. (To grant worthy real data) ! Email address : Here grant your real email address. Choose the password : Select a password (there have to be at least 8 characters) First name : Your first name Last name : Y...
ManOS Overview Everything below is rooted in my core value of creating selfesteem. My actions today focus on work, girls, travel & having fun. My career is the ultimate leverage point as this creates the money, selfesteem and confidence. The money allows me to travel and the selfesteem & confidence allow me to live the lifestyle that is congruent with drawing in girls. Long term (5+ years), I want my life to offer value to the world by having a beneficial impact on those around me. I am obviously not clear how I will do this, so for now, I am focused on taking the greatest strides possible over the next few years, to better put me in a position to achieve my long term goal. 1. Career Vision I want to earn the rank of manager in my firm within the next 3 years. I want to earn the respect and trust of fellow employees. I want to become an integral member of my team by providing distinct and high quality service to my clie...
WORD FORMATION Exercise I 1. Chestnut honey provides quick and ............. relief.(EFFECT) 2. Come rain, wind or shine these snapdragons give a superb display over an ....................... long period. (EXCEPTION) 3. Dreaming of a beautiful home for your ........................... .(RETIRE)? Enjoy lifetime ownership of a luxury home for an ................. price.(AFFORD) 4. The post-war decline in beer ......................... was practically halted last year. (CONSUME) 5. Better is a dinner of herbs where love is, than a stalled ox and ..................therewith.(HATE) 6. In the first quarter of the 18th century people began to realise the ......................... of hygiene to public health.(IMPORTANT) 7. The ....................collapse of the Roman Empire lasted for nearly three hundred years before its final dissolution in AD 476.(GRADE) 8. Jamie's ....................of the night's events is hazy but the tabloids will re...
Life in Estonia through the eyes of an economics student With a population of 1 313 271 people, Estonia is one of the least populous member states of the European Union. However, according to the IMF, it is a developed country with an advanced and high-income economy. Estonia follows market economy system which ensures the little government intervention and the determination of prices of goods and services in a free price system. Therefore, economic decisions are guided solely by the aggregate interactions of a country's citizens and businesses. In addition to mentioned afore, Estonia tends to perform favourably in measurements of civil liberties, education, and press freedom. Living in Estonia has many of its good sides, for instance it is a secure place from nature disasters and it has a beautiful nature. Although, when not to look only through rose-tinted glasses, there are still some minuses in country’s organiz...
Case Google 1. What were the key factors behind Google's early success? There were 4 main key factors behind Google's early success: · Perfecting an innovative search engine- clearly the most important factor for Google's success. Google stopped counting keywords like old search engines and started using famous Page Rank algorithm. A reliable searches through the number of websites that link to a page to weight search result relevance. · Google focusing on the user- Focus on the user and all else will follow. Attraction for users were the no-nonsense simple white search pages and distractive colorful logo with no ads or editorial content on the page lead to easy and fast search that Yahoo couldn't imitate. · Google delivered search results people really wanted- trustworthy for users. The promised not to sell placement in search results to advertisers and instead ...
TALLINNA ÜLIKOOL POLITICAL SCIENCE AND GOVERNMENT INSTITUTE ANNELI PALM CRITISIM ABOUT IMF AND WORLD BANK INTERNATIONAL POLITICAL ECONOMY (RIR6032/RIR6004) ESSAY 2014 Contents TALLINNA ÜLIKOOL.............................................................................................. 1 Introduction............................................................................................................ 3 Basic of liberalism.................................................................................................. 4 International Monetary Fund and World Bank.........................................................4 IMF(International Monetary Fund)........................................................................4 WB(World Bank).................................................................................................
VEEBIT EENUSED. KONT ROLLTÖÖ. SOA o A service-oriented architecture (SOA) is an architectural pattern in computer software design in which application components provide services to other components via a communications protocol, typically over a network. The principles of service-orientation are independent of any vendor, product or technology. o Kasutab XMLi sõnumivahetuseks o Võimalus integreeride süsteeme Service-oriented architecture (SOA) Arhitektuur, mis kasutab – teenuseid organisatsiooni integrastiooni ehitusklotsidena – komponentide taaskasutust läbi nõrga seotuse. SOA: On arhitektuur Mingi hulga teenuste tegemine ei anna meile SOA-d. Arhitektuur peab andma meile juhised teenuste loomiseks. SOA: Ehitatakse teenustest Nagu objekt-orienteeritud maailmas on objekt/klass nii on SOA-s teen...
An overview of integrated care in the NHS What is integrated care? Research report Sara Shaw, Rebecca Rosen and Benedict Rumbold June 2011 Nuffield Trust work on integrated care This report is part of the Nuffield Trust's extensive programme of work on integrated care, which is examining the potential of new forms of care that are intended to benefit patients and taxpayers. Other related projects include: ·Integration in action: four international case studies. A study of four international organisations that have attempted to improve integration between health and care services. Interviews, documentary analysis and literature review are used to identify the main stimuli for integration and the issues that help or hinder progress; drawing out lessons for the NHS. ·Towards integrated care in Trafford. A project that looks at the process of change and lessons learned to date in Trafford, where NHS organisations have been worki...
Rare animals Rare Chinese tiger seen in the wild Researchers have confirmed that a wild tiger, photographed by a farmer in the Qinba Mountains of Shaanxi Province, Central China, is indeed that of the critically endangered South China tiger. The South China tiger classified as one of only five subspecies of tiger still alive today is extremely rare, with only an estimated 20 to 30 still remaining in the wild. The wildlife and conservation group WWF says the South China tiger is actually native to the Hainan most forests of south-east China, and because there are so few individuals left, it is regarded by many scientists as being "functionally extinct" in the wild. But a group called Save China's Tigers has been working on a captive- breeding programme and hopes to reach an agreement with China's State Forestry Administration to reintroduce captive-bred animals into the wild. If all goes...
Tallinna Tehnikaülikool Raadio- ja sidetehnika instituut Projekt ainetes ,,IRT0030 Andmeside" ja ,,IRT0100 Kommunikatsioonivõrkude struktuurid ja teenused" teemal «VoIP teenus» Üliõpilane: Ruslan Karpovits Õpperühm: IATM Matrikli nr: 050829 Õppejõud: Avo Ots Tallinn 2008 Author's word This project is written to show some interesting aspects of working with VoIP (Voice over Internet Protocol) service. The project briefly describes the process of finding a solution for based VoIP proble...
Idealization of Nature in Romantic Poetry One of the main characteristics of romanticism in general is the constant praising of nature and connecting it with almost everything. As the second half of the 18 th century was the time of the industrial revolution, urbanization and mankind's distancing from nature in every way, it is not surprising that as a result it became more and more important to and valued by people it had suddenly become something remote and far from everyday life, somewhat a luxury. The utmost way this luxury manifests in romantic poetry is nature's ability to help whoever takes the time to value its divinity get in touch with themselves and get away from everything that might influence their way of acting. Nature provides the ideal atmosphere and surroundings to do this in the opinion of romantic poets, it is the very best place to come to when in need of solitude or an answer to personal or social conflicts....
Bioinformaatika ülesanded Järjestuste võrdlemine, otsingud andmebaasidest (BLAST, FASTA, SW). 1. BLAST programmide kasutamine tundmatu valgujärjestuse identifitseerimiseks või sarnaste valgujärjestuste leidmiseks (http://www.ncbi.nlm.nih.gov/BLAST/). Programmide kasutamisel tutvuda tutorialite ja juhenditega!!! (http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/information3.html). a. Otsida sarnaseid järjestusi antud valgujärjestusele. Valida sobiv programm vastavalt NCBI juhendile valgujärjestuse võrdlemiseks valgujärjestuste seast. Valida otsimiseks Refseq andmebaas, sooritada otsing, tulemuste formaat 500 joondamise jaoks. GTESPLLTDPSTPNFFWLAWQARDFMSKKYGQPVPDRAVSLAINSRTGRTQNHFHIHISCIRPDVRKQLDNNLAN ISSRWLPLPGGLRGHEYLARRVTESELVQRSPFMMLAEEVPEAREHMGRYGLAMVRQSDNSFVLLATQRNLLTLN RASAEEIQDHQCEILRMRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEM...
1. OBJECT-ORIENTED PARADIGM The Model •The model defines an abstract view to the problem. This implies that the model focuses only on problem related stuff and that you try to define properties of the problem. These properties include: 1 •the data which are affected and 2 •the operations which are identified by the problem. Object-oriented Paradigm •Everything is an object •A program is a bunch of objects telling each other what to do by sending messages •Each object has its own memory made up of other objects •Every object has a type •All objects of a particular type can receive the same messages Domain Model •A domain model does not represent the entire domain as it is in the real world. It includes only the concepts that are needed to support the application. Object •Is a partitioned area of memory where object code is stored •The area of memory is protected •This code can function relatively independently of othe...
Starteegiline juhtimine, eksamiks valmistumine Strateegilise üldjuhtimise tsükkel: kavandamine, korraldamine, kontroll Strateegiline plaanimine - on organisatsiooni sise- ja väliskeskkonna analüüsiprotsess, määramaks põhilised eesmärgid, mis aitavad äriühingul täita oma missiooni ja liikuda oma visiooni suunas. Starteegilise juhtimise tsükkel: visioon/mission, väärtused; teadmised, oskused; tegevused, tulemused-tagasiside. Strateegia on eesmärgistatud kavand, mis sobitab omavahel organisatsiooni ressursid, struktuuri ja kultuuri (tugevused, nõrkused) väliskeskkonna muutustega (võimalused, ohud). Strateegiline juhtimine on otsuste ja tegevuste kogum, mis kindlustab pikas perspektiivis äriühingu jätkusuutliku tulemuslikkuse. • Organisatsiooni seire, formuleerimise, elluviimise, hindamise ja kontrolli protsess. Strateegilist juhtimist iseloomustab: • Interdistsiplinaarsus Organisatsioon kui tervik • Fookus väliskeskkonnale Majan...
BOOK REPORT Title & author of the book: 'Anita and Me' by Meera Syal The setting of the book? The story resolves around Meena Syal, the daughter of the only Punjabi family in the Midlands' mining village of Tollington. The novel provides a vision of British childhood in the 1960s, a childhood caught between two cultures, each on the brink of enormous change. Meena is desperate to fit in with the other children in her neighbourhood while forever feeling like an outsider because she is "different". Eventhough the Punjabi family is well respected by the locals, there are still sutations when they have to deal with racism. Plot summary (NB! Use the present tenses) Anita and Me by Meera Syal is the story of a young Punjabi girl growing up in the fictional English village of Tollington in the Midlands in the 1960s. The book follows Meena during her pre-teen years as she is desperate to fit in ...
Tallinna Polütehnikum Automation Author: TomTom2 Group :AA-09 Instructor: Marina Zotikova Tallinn 2010 Contents Introduction......................................................................................................................3-4 Person Knowledge Technologies supports......................................................................4-6 Online Essay Evaluation Service.....................................................................................6-7 WordNet lexical database................................................................................................7-8 Practice Online (TPO)................................................................................................
The Republic of Cameroon Cameroon · A unitary republic of central and western Africa · Bordered by Nigeria to the west; Chad to the northeast; the Central African Republic to the east; and Equatorial Guinea, Gabon, and the Republic of the Congo to the south. · Cameroon's coastline lies on the Bight of Bonny, part of the Gulf of Guinea and the Atlantic Ocean. · The country is called "Africa in miniature" for its geological and cultural diversity. History · The territory of present day Cameroon was first settled during the Neolithic · Portuguese sailors reached the coast in 1472 · The German Empire claimed the territory as the colony of Kamerun in 1884 and began a steady push inland. · An economic crisis took effect in the mid-1980s to late 1990s as a result of international economic conditions, drought, falling petroleum prices, and years of corruption, mismanagement, and ...
BARRIERS TO DISTRICT HEATING DEVELOPMENT IN SOME EUROPEAN COUNTRIES Abstract District heating (DH) offers low primary energy demand, high security of supply and small CO 2 emissions. Barriers to DH in the UK, Ireland, France, Romania and the Czech Republic have been compiled through publications and interviews. DH systems require large investments, have negative initial cash flow and long payback time, which obstructs financing. One actor should control DH from source to consumption. If the value chain is fragmented, contracts are required between the links. It increases risks and financing costs, like in the UK and Ireland, where DH is not established. There are few multi- family houses with central heating and it is expensive to build DH networks in built areas. Most French DH systems are operated according to long-term concessions by companies that sell electricity and gas. No strong actor provid...
Test VIII - cumulative test by Piigli, Mets, Parker, Kauler "Top delusion" question / answers are red. Test I The induction machines are associated with the names of Dolivo - Dobrovolsky, Tesla. The synchronous machines are associated with the name of Ferraris. The DC machines are associated with the names of Jacobi and Henry. The electromagnetic torque is born in air gap. The torque is proportional to the current in dc motor. Which equations are correct? P = sW; oomega = tuletis fii'st The angular frequency is 2*pi()*n / 60 ja 2*pi()f The motor torque is equal to TL + J * oomega tuletis aja järgi The inductor supplies the motor with flux. The leading companies in the world market of electrical drive engineering are: Mitsubishi. The energy balance is described by energy conservation law. The armature supplies the motor with current. The cheapest and the most r...
TALLINNA TEHNIKAÜLIKOOL Ärikorralduse instituut Ruslan Karpovits 050829 IATM Stretches and exercises in office Referaat Esitatud: 22.09.2008. Juhendajad: Ülo Kristjuhan Tallinn 2008 Stiff neck, back and wrist pain, poor circulation - these are just some of the health hazards that can come with having an office job. It doesn't have to be that way. Human bodies are made to move. It is recommended that a person break for 5-10 minutes for every hour spent at a workstation. Working "mini" activity breaks into your day can really make a difference in how you feel and even how well you perform your job. Even the busiest person can do it. Just five minutes of movement every hour or two can boost energy and improve your attitude. You'll find that getting your blood pumping and oxygen circulating will help you concentrate better and be ...
Tallinn´s University Pedagogical College Department of Youth Work and Continuing Education Andra Pant NT-32 GETTING PHYSICAL Tallinn 2012 "Delivery is more important than content." Arch Lustberg, speech trainer According to wellknown social anthropologist Edward T. Hall, 60% of our communication is nonverbal. That means whenever we stand before an audience, our stance, our posture, our facial expressions, our hand gestures, our whole body dynamic communicate more than our actual spoken words. A stiff, immobile speaker is often a boring and usually ineffective speaker as. It is theref...
Estonian Economy Estonians earn about half of the average European income, despite the fact that the economic growth during the recent years has been very fast and the differences have been diminishing. Although the extremely vigorous period of economic reforms is now over, the changes that Estonia is presently going through are far more extensive than those in the developed countries. The Estonian economy is diverse industry and transport, as well as commerce and different branches of services are all equally important. Due to the available natural resources Estonian economy largely relies on the branches related to the forest; Estonian energy sector is based on oil shale, a resource quite rare elsewhere in the world. Finland and Sweden are the most important trade partners. The Estonian economy profits significantly from the business generated by more than 2 million tourists a year, most of who...
BEDOUINS REFERAAT Õppeaines: INGLISE KEEL Arhitektuuri- ja keskkonnatehnika teaduskond Õpperühm: TÖ 21A Juhendaja: M.Kala Tallinn 2009 1. Who are bedouins? Bedouins are Arabic speaking nomadic tribes that originate from the Arabian Peninsula (mainly Saudi Arabia) and would travel the desert to locations where they would find drink and food. Sometimes traveling for days before they arrived at their final destinations. Each tribe would have an area of land under their responsibility from which they would make income by allowing travelers and traders to pass through. As knowledgeable guides of the desert they controlled the desert trade routes, and escorted caravans. Table 1. Bedouin Total population Regions Languages Religion Related ...
SCHOOL Academic English course Hypermobility. The effect of hypermobility on flexibility. A research paper Student: Grade: 10 Tutor: Tallinn 2016 Joint Hypermobility Syndrome (JMS) is a condition which describes joints that are able to bend further than normal. The syndrome is generally induced by changes in bone structure. It occurs in about 10%-25% of the world’s population.1 Joint hypermobility causes several effects, both positive and negative. This essay describes the syndrome briefly as well as discusses the benefits and consequences of the condition. However, the expedience of the condition outweighs the negative issues JMS can bring about. Hypermobile joints are a serious case in which the tissue...
TALLINN UNIVERSITY OF TECHNOLOGY SUSTAINABILITY REPORTING GUIDELINES Report Composers: Meelika Koitjärv EABM03 000502 Sandra Oisalu EABM03 000484 Tallinn 2004 2 PREFACE The Board of Directors of the Global Reporting Initiative (GRI) is pleased to release the 2002 Sustainability Reporting Guidelines. From an institutional perspective, it marks the beginning of the cycle of release, testing, review, and revision under GRIs new governance structure. The GRI was launched in 1997 as a joint initiative of the U.S. non-governmental organisation Coalition for Environmentally Responsible Economies (CERES) and United ...
22 Myers, Kitsuse 2000 Constracting the Future in Planning Planning’s broad relevance and its interdisciplinary inclusiveness have served as both a strength and a vulnerability. One emphasis that has been identified as central to the intellectual and professional identity or mission of planning is “foresight” (Markusen 1998), “a focus on the future and pathways of change over time” (Strategic Marketing Committee of ACSP 1997), or “persuasive storytelling about the future” A Surprising Neglect (hüljatud). “....planning has lost sight of the future....Planning voluntarily is sacrificing its role as visionary and idealist and is abandoning its responsibility to be a source of inspiration and ideas about what might be and what ought to be”. In planning practice, the recent surge of interest in visioning exercises has raised awareness of planners’ role in shaping the future, in some cases 3 bri...
Nowadays watchung TV takes up much of oru time.Many people spend their free time in fornt of a TV set.However, watching TV has many advantages and disadvantages. The main advantage of watching Tv is the source of information.We can watch many educational programmes about animals, discoveries, history, physics and many other domains of science.Thank to TV we can get to knowabout the coulture of other countries. We can also do shopping via TV shpping channels. On the other hand, there are a lot of disadvantages. TV absorbsus much time, which could bring many ilness. TV programmes show violence in fairy-tales, cartoons andprogrammes for children. Watching TV can limit children's imagination. In conclusion, I think that people should limit watching TVand start spending their free time in an active way. Tänapäeval valib telekanal palju aega või aega. Paljud inimesed veedavad oma vaba aega televiisoriga varustatuna. Kuid telerivaatamisel on p...
The Essay Writing Manual Brain Storming The process of writing the application essay can be broken into five very basic parts: Brainstorming Selecting the essay topic Writing the essay Revising the essay Coming up with the final draft 1. BRAINSTORMING: Brainstorming is the process of coming up with ideas spontaneously from free flowing writing or talking. To brainstorm, you can simply sit down with a pen and jot down every idea that comes into your head. Another approach is to simply start writing and see where you end up. Record as much information as you can recall, such as schools attended, courses taken, jobs held, research projects undertaken. Work on taking yourself deeper into the introspection process by tackling more specific topics. Here are some questions you might want to consider: What am I like? How do my friends characterize me? What are my personality traits? Have I ever experienced a moment of ...
Philosophy Aristotle - four causes or better "becauses" because they are the 4 ways in which we use the word "because" or answer the question "why?" 1. Material cause: - what it is made of - why is the bridge strong? because made of steel 2. Formal cause: - what form, definition or property it has - why is this salt? because made of sodium and chloride 3. Efficient cause: - what initiated the change or movement - why did the baseball move? because someone hit it 4. Final cause: - what end or goal does it have? - why does he walk? because he wants to be healthy - also nature operates in terms of final causes - things don't happen spontaneously, every action that nature takes is for the sake of something, everything has a p...
1. UN as a world organization The United Nations officially came into existence on 24 October 1945, when the UN Charter had been ratified by a majority of the original 51 Member States. The day is now celebrated each year around the world as United Nations Day. The purpose of the United Nations is to bring all nations of the world together to work for peace and development, based on the principles of justice, human dignity and the well-being of all people. It affords the opportunity for countries to balance global interdependence and national interests when addressing international problems. There are currently 192 Members of the United Nations. The Aims of the United Nations: -To keep peace throughout the world. -To develop friendly relations between nations. -To work together to help people live better lives, to eliminate poverty, disease and illiteracy in the world, to stop environmental destruction and to encourage respect for ea...
Tallinna Inglise Kolledz Australia Topic Alice Tärk, 8b. Tallinn 2007 Table of contents: Factfile............................................................................................. ................................. Symbols.......................................................................................... ....................................Head of State................................................................................................ ................... Government....................................................................................... ............................... History............................................................................................. .................................. Relief..................................................................................................
Mass Media What is Mass Media? Statistics show that there are few things which impact the human mind more than mass media. The advice of teachers, parents and relatives may fall on deaf ears, but the mass media influence holds us all spellbound! At this point, it becomes necessary to define mass media. Mass media may be defined as any form of communication which is meted out to the people at large, through the various forms of communication. What modes of communication are we talking about? Well there can be no static definition for the channels of mass communication as they are increasing all the time. But any form of communication which is seen and understood by a large mass of people can be taken to mean mass communication or mass media channels. Why is mass media so attractive to people? Mass media holds a kind of mystique in the minds of the people. It is because the communication is designed in ...
Tartu Miina Härma gymnasium Biogas The source of future energy Report Tartu 2010 Table of Contents Introduction......................................................................................................... What is biogas?................................................................................................... Producing process............................................................................................... Nowadays............................................................................................................ Areas where biogas is used in............................................................................. Biogas as replacement of fuel.......................................................................... Other benefits.......................................................................
Ergo Pikas Integration of Lean Construction and Building Information Modelling DISSERTATION Tallinn 2010 2 UNIVERSITY OF APPLIED SCIENCES Author: Ergo Pikas- Civil Engineering student, Faculty of Construction, Tallinn University of Applied Sciences Supervisor: Rafael Sacks- Associate Professor, Faculty of Civil and Env. Engineering, Technion Israel Institute of Technology Consultant: Roode Liias- Professor and Dean, Faculty of Civil Engineering, Tallinn University of Technology Title: Integration of Lean Construction and Building Information Modelling Archived: University of Applied Sciences, Faculty of Construction ABSTRACT This research can be divided into two. The first part investigates the current state of the construction industry, ...
1 System development • Modelling in early system development stage corrects design errors before construction. • Beneficial modelling reasons (– Insight: in the design and operation of a system – Completeness: detection of missing parts for simulation and a better understanding of the system requirements – Correctness: errors and flaws are usually detected, problematic scenarios can be reproduced, systematic error investigation) 2 Introduction CPN • CPN is a graphical language for concurrent system design and analysis and also general-purpose modelling environment and also applicable for industrial projects and high level programming. • Petri nets provide(– graphical notation– modelling concurrency, communication, synchronisation) • CPN application domains that are typical(– communication protocols, data networks, distributed algorithms) • ...
Traveling Description Traveling is the movement of people or objects (conveyances) between relatively distant geographical locations. Travel may occur by human-powered transport such as walking or bycycling, or with vehicles, such as public transport, automobiles, trains and airplanes. Etymology The term "travel" originates from the Old French word travail. The term also covers all the activites performed during a travel (movement). A person who travels is spelled "traveler" in the United states, and "traveller" in the United Kingdom. Purpose and motivation Reason for traveling include recreation, tourism or vacationing, research travel for gathering information, for holiday to visit people, volunteer travel for charity, migration to begin life somewhere else, religious pilgrimages and mission trips, business travel, trade, commuting, and other reason, such as to obtain health care or ...
Tartu Kivilinna Gümnaasium Liis Viljak 10b Bodyshop Company The Body Shop International plc is a global manufacturer and retailer of naturally inspired, ethically produced beauty and cosmetics products. Founded in the UK in 1976 by Dame Anita Roddick, we now have over 2,100 stores in 55 countries, with a range of over 1,200 products, all animal cruelty free, and many with fairly traded natural ingredients. We were the first international cosmetics brand to be awarded the Humane Cosmetics Standard for our Against Animal Testing policy. And we have our own fair trade programme called Community Trade, making us the only cosmetics company with such an extensive commitment to trading fairly. Community Trade now works with 31 suppliers in 24 countries, providing over 15,000 people across the globe with essential income to build their futures. The Body Shop is a leader in the trend towards greater corporate transp...
annaabi.ee 
