Vajad kellegagi rääkida?
Küsi julgelt abi LasteAbi
✍🏽 Avalikusta oma sahtlis olevad luuletused! Luuletus.ee Sulge
Add link

Kategooria bioinformaatika - 7 õppematerjali

Informaatika >> Bioinformaatika
bioinformaatika on suhteliselt uus interdistsiplinaarne teadussuund, mida võib määratleda kui ühenduslüli bioloogia ja arvutiteaduste vahel.
2
doc

Bioinformaatika ülesanded II - Fülogeneetilised puud.

1. DNA järjestuste fülogeneetiliste puude käsitsi koostamine kasutades kaugusmeetodeid (UPGMA, NJ). a. Moodustada antud 5 järjestuse kaugusmaatriks ning joonistada kvantitatiivne juurtega fülogeneetiline puu kasutades UPGMA meetodit. 1 ACAAACAGTT CGATCGATTT GCAGTCTGGG 2 ACAAACAGTT TCTAGCGATT GCAGTCAGGG 3 ACAGACAGTT CGATCGATTT GCAGTCTCGG 4 ACTGACAGTT CGATCGATTT GCAGTCAGAG 5 ATTGACAGTT CGATCGATTT GCAGTCAGGA b. Koostada eelpool toodud järjestuste fülogeneetiline puu kasutades Neighbour Joining meetodit. c. Valida 4 järjestust (ülevalt) ja leida informatiivsed positsioonid (ML meetod). Koostada kõik võimalikud sugupuud (ML meetod) kasutades ainult informatiivsetest positsioonidest koosnevaid järjestusi, märkida mutatsioonide arv igale puuharule, leida kõige tõenäolisem sugupuu. d. Võrrelda tulemusi...

Bioinformaatika - Tallinna Tehnikaülikool
40 allalaadimist
21
doc

Bioinformaatika arvestus ül

Kristina Raud YAGB-41 060290 10.04.07 Bioinformaatika ülesanded Fülogeneetilised puud. 1. DNA järjestuste fülogeneetiliste puude käsitsi koostamine kasutades kaugusmeetodeid (UPGMA, NJ). a. Moodustada antud 5 järjestuse kaugusmaatriks ning joonistada kvantitatiivne juurtega fülogeneetiline puu kasutades UPGMA meetodit. 1 ACAAACAGTT CGATCGATTT GCAGTCTGGG 2 ACAAACAGTT TCTAGCGATT GCAGTCAGGG 3 ACAGACAGTT CGATCGATTT GCAGTCTCGG 4 ACTGACAGTT CGATCGATTT GCAGTCAGAG 5 ATTGACAGTT CGATCGATTT GCAGTCAGGA Vastus: A B C D B 9 C 2 11...

Bioinformaatika - Tallinna Tehnikaülikool
34 allalaadimist
79
doc

BIOinformaatika kodutöö 5

KEGG-i kasutamine (http://www.genome.jp/ a. Leida liikide Escherichia coli K12 MG1655, Drosophila melanogaster ja Homo sapiens glükolüüsi rajad ning ensüümid aldolaas ja püruvaatkinaas. Escherichia coli glükolüüsi rada: http://www.kegg.com/dbget-bin/get_pathway?org_name=eco&mapno=00010 Drosophila glükolüüsi rada: http://www.kegg.com/dbget-bin/get_pathway?org_name=dme&mapno=00010 Homo sapiens glükolüüsi rada: http://www.kegg.com/dbget-bin/get_pathway?org_name=hsa&mapno=00010 aldodaas: http://www.kegg.com/dbget-bin/www_bget?enzyme+4.1.2.13 püruvaatkinees: http://www.kegg.com/dbget-bin/www_bget?enzyme+2.7.1.40 b. Leida vastavad geenid ­ KEGG-i entry numbrid, geeni nimed, nukleotiidsed järjestused ning asukohad geenikaardil. Aldolaas : Escherichia coli K12 MG1655: h...

Bioinformaatika - Tallinna Tehnikaülikool
43 allalaadimist
24
doc

Bioinformaatika ülesanded

1. Milliste ülesannete lahendamisel on vajalik järjestuste joondamine? 2. Kasutada suvalist dot ploti visualiseerimise programmi (näiteks DotMatcher http://mfgn.usm.edu/cgi-bin/emboss.pl?_action=input&_app=dotmatcher või DotPlot'i applet http://arbl.cvmbs.colostate.edu/molkit/dnadot/index.html). Leida järgnevate nukleotiidsete järjestuste paaride sarnased piirkonnad erinevatel raami suurustel ja sarnasuse piirväärtustel ­ raam = 1, lim = 0. Leida kõik suuremad sarnased piirkonnad varieerides raami ja piirväärtuse suurust, põhjendada tulemuste seost parameetrite väärtustega. Millise nähtusega võiks tegemist olla? · atgttgatgattaaaggaattatttttgatatggacggtgttttatttgatacagaacctttttatctgaggcg acgagaagatttttttaagacaaagggaattcccattgatcacttgaactctaaa...

Bioinformaatika - Tallinna Tehnikaülikool
33 allalaadimist
0
rar

Bioinformaatika kodutööd 2014

...

Bioinformaatika - Tallinna Tehnikaülikool
15 allalaadimist
1
doc

Bioinformaatika kodutöö 2

VAADELDAV VALK: Forkhead box protein O3 Transkriptide võrdlus Homo Sapiens FoxO3 järjestusega Kattuvad Organism Järjestuse ID Pikkus järjestused Identsed alused Tühikud Pan troglodytes Simpans ref|XM_003311514.2| 7946 1 7076/7133(99%) 18/7133(0%) Sumatra Pongo abelii Orangutan ref|XM_002817219.2| 7812 1 7190/7343(98%) 46/7343(0%) Gorilla gorilla gorilla Gorilla ref|XM_004044495.1| 7595 1 7024/7175(98%) 73/7175(1%) Macaca mulatta Reesusmakaak ref|XM_001093593.2| 7300 1 7079/7328(97%) 66/7328(0%) Papio anubis Anubis baboon ref|XM_003898343.1| 7775 1 7094/7353(96%) 60/7353(0%) Dasypus 4216/4873(87%) 16...

Bioinformaatika -
25 allalaadimist
23
doc

Järjestuste võrdlemine, otsingud andmebaasidest (BLAST, FASTA, SW).

1. BLAST programmide kasutamine tundmatu valgujärjestuse identifitseerimiseks või sarnaste valgujärjestuste leidmiseks (http://www.ncbi.nlm.nih.gov/BLAST/). Programmide kasutamisel tutvuda tutorialite ja juhenditega!!! (http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/information3.html). a. Otsida sarnaseid järjestusi antud valgujärjestusele. Valida sobiv programm vastavalt NCBI juhendile valgujärjestuse võrdlemiseks valgujärjestuste seast. Valida otsimiseks Refseq andmebaas, sooritada otsing, tulemuste formaat 500 joondamise jaoks. GTESPLLTDPSTPNFFWLAWQARDFMSKKYGQPVPDRAVSLAINSRTGRTQNHFHIHISCIRPDVRKQLDNNLAN ISSRWLPLPGGLRGHEYLARRVTESELVQRSPFMMLAEEVPEAREHMGRYGLAMVRQSDNSFVLLATQRNLLTLN RASAEEIQDHQCEILRMRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHI...

Bioinformaatika - Tallinna Tehnikaülikool
35 allalaadimist


Registreeri ja saadame uutele kasutajatele
faili e-mailile TASUTA

Konto olemas? Logi sisse

Sellel veebilehel kasutatakse küpsiseid. Kasutamist jätkates nõustute küpsiste ja veebilehe üldtingimustega Nõustun