Vajad kellegagi rääkida?
Küsi julgelt abi LasteAbi
Logi sisse Registreeri konto
✍🏽 Avalikusta oma sahtlis olevad luuletused! Luuletus.ee Sulge

Kategooria bioinformaatika - 7 õppematerjali

Informaatika >> Bioinformaatika
bioinformaatika on suhteliselt uus interdistsiplinaarne teadussuund, mida võib määratleda kui ühenduslüli bioloogia ja arvutiteaduste vahel.
thumbnail
2
doc

Bioinformaatika ülesanded II - Fülogeneetilised puud.

1. DNA järjestuste fülogeneetiliste puude käsitsi koostamine kasutades kaugusmeetodeid (UPGMA, NJ). a. Moodustada antud 5 järjestuse kaugusmaatriks ning joonistada kvantitatiivne juurtega fülogeneetiline puu kasutades UPGMA meetodit. 1 ACAAACAGTT CGATCGATTT GCAGTCTGGG 2 ACAAACAGTT TCTAGCGATT GCAGTCAGGG 3 ACAGACAGTT CGATCGATTT GCAGTCTCGG 4 ACTGACAGTT CGATCGATTT GCAGTCAGAG 5 ATTGACAGTT CGATCGATTT GCAGTCAGGA b. Koostada eelpool toodud järjestuste fülogeneetiline puu kasutades Neighbour Joining meetodit. c. Valida 4 järjestust (ülevalt) ja leida informatiivsed positsioonid (ML meetod). Koostada kõik võimalikud sugupuud (ML meetod) kasutades ainult informatiivsetest positsioonidest koosnevaid järjestusi, märkida mutatsioonide arv igale puuharule, leida kõige tõenäolisem sugupuu. d. Võ...

Bioinformaatika
42 allalaadimist
thumbnail
21
doc

Bioinformaatika arvestus ül

Kristina Raud YAGB-41 060290 10.04.07 Bioinformaatika ülesanded Fülogeneetilised puud. 1. DNA järjestuste fülogeneetiliste puude käsitsi koostamine kasutades kaugusmeetodeid (UPGMA, NJ). a. Moodustada antud 5 järjestuse kaugusmaatriks ning joonistada kvantitatiivne juurtega fülogeneetiline puu kasutades UPGMA meetodit. 1 ACAAACAGTT CGATCGATTT GCAGTCTGGG 2 ACAAACAGTT TCTAGCGATT GCAGTCAGGG 3 ACAGACAGTT CGATCGATTT GCAGTCTCGG 4 ACTGACAGTT CGATCGATTT GCAGTCAGAG 5 ATTGACAGTT CGATCGATTT GCAGTCAGGA Vastus: A B C D B 9 C 2 11...

Bioinformaatika
38 allalaadimist
thumbnail
79
doc

BIOinformaatika kodutöö 5

KEGG-i kasutamine (http://www.genome.jp/ a. Leida liikide Escherichia coli K12 MG1655, Drosophila melanogaster ja Homo sapiens glükolüüsi rajad ning ensüümid aldolaas ja püruvaatkinaas. Escherichia coli glükolüüsi rada: http://www.kegg.com/dbget-bin/get_pathway?org_name=eco&mapno=00010 Drosophila glükolüüsi rada: http://www.kegg.com/dbget-bin/get_pathway?org_name=dme&mapno=00010 Homo sapiens glükolüüsi rada: http://www.kegg.com/dbget-bin/get_pathway?org_name=hsa&mapno=00010 aldodaas: http://www.kegg.com/dbget-bin/www_bget?enzyme+4.1.2.13 püruvaatkinees: http://www.kegg.com/dbget-bin/www_bget?enzyme+2.7.1.40 b. Leida vastavad geenid ­ KEGG-i entry numbrid, geeni nimed, nukleotiidsed järjestused ning asukohad geenikaardil. Aldolaas : Escherichia coli K12 MG165...

Bioinformaatika
45 allalaadimist
thumbnail
24
doc

Bioinformaatika ülesanded

1. Milliste ülesannete lahendamisel on vajalik järjestuste joondamine? 2. Kasutada suvalist dot ploti visualiseerimise programmi (näiteks DotMatcher http://mfgn.usm.edu/cgi-bin/emboss.pl?_action=input&_app=dotmatcher või DotPlot'i applet http://arbl.cvmbs.colostate.edu/molkit/dnadot/index.html). Leida järgnevate nukleotiidsete järjestuste paaride sarnased piirkonnad erinevatel raami suurustel ja sarnasuse piirväärtustel ­ raam = 1, lim = 0. Leida kõik suuremad sarnased piirkonnad varieerides raami ja piirväärtuse suurust, põhjendada tulemuste seost parameetrite väärtustega. Millise nähtusega võiks tegemist olla? · atgttgatgattaaaggaattatttttgatatggacggtgttttatttgatacagaacctttttatctgaggcg acgagaagatttttttaagacaaagggaattcccatt...

Bioinformaatika
35 allalaadimist
thumbnail
0
rar

Bioinformaatika kodutööd 2014

docstxt/1419191184674.txt...

Bioinformaatika
16 allalaadimist
thumbnail
1
doc

Bioinformaatika kodutöö 2

VAADELDAV VALK: Forkhead box protein O3 Transkriptide võrdlus Homo Sapiens FoxO3 järjestusega Kattuvad Organism Järjestuse ID Pikkus järjestused Identsed alused Tühikud Pan troglodytes Simpans ref|XM_003311514.2| 7946 1 7076/7133(99%) 18/7133(0%) Sumatra Pongo abelii Orangutan ref|XM_002817219.2| 7812 1 7190/7343(98%) 46/7343(0%) Gorilla gorilla gorilla Gorilla ref|XM_004044495.1| 7595 1 7024/7175(98%) 73/7175(1%) Macaca mulatta Reesusmakaak ref|XM_001093593.2| 7300 1 7079/7328(97%) 66/7328(0%) Papio anubis Anubis baboon ref|XM_003898343.1| 7775 1 7094/7353(96%) 60/7353(0%) Dasypus 4216/4873(8...

Bioinformaatika
28 allalaadimist
thumbnail
23
doc

Järjestuste võrdlemine, otsingud andmebaasidest (BLAST, FASTA, SW).

1. BLAST programmide kasutamine tundmatu valgujärjestuse identifitseerimiseks või sarnaste valgujärjestuste leidmiseks (http://www.ncbi.nlm.nih.gov/BLAST/). Programmide kasutamisel tutvuda tutorialite ja juhenditega!!! (http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/information3.html). a. Otsida sarnaseid järjestusi antud valgujärjestusele. Valida sobiv programm vastavalt NCBI juhendile valgujärjestuse võrdlemiseks valgujärjestuste seast. Valida otsimiseks Refseq andmebaas, sooritada otsing, tulemuste formaat 500 joondamise jaoks. GTESPLLTDPSTPNFFWLAWQARDFMSKKYGQPVPDRAVSLAINSRTGRTQNHFHIHISCIRPDVRKQLDNNLAN ISSRWLPLPGGLRGHEYLARRVTESELVQRSPFMMLAEEVPEAREHMGRYGLAMVRQSDNSFVLLATQRNLLTLN RASAEEIQDHQCEILRMRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEM...

Bioinformaatika
39 allalaadimist


Sellel veebilehel kasutatakse küpsiseid. Kasutamist jätkates nõustute küpsiste ja veebilehe üldtingimustega Nõustun