WORD SEARCH P S U N N Y I F X F F T T P E W O B T Y E D U Y T S J N O G W C S S O U E E H V O N E P A Q X F S Z B N N Z Y A W G U M H I L R I Y Y H G A X U I L A H Q O L U B U O E S U W L A D G V T F O Y L Q E B S Q L R G T V M G X O L E F W G H E B D F N P E H C C R E L F K T Y Y Y W E C H O N E S T L Y N L L E O Y I N Y F I R R E T I E D T S U T T Q N U A N W T C I H P R R T H A F J K M T N P K X M O M U H S P L X W A P ...
Prinditavate õppematerjalide koostamine veebis Juhendi koostas Margit Lindau 1. Puzzlemaker.discoveryeducation.com keskkond Word search Alusta kodulehelt http://puzzlemaker.discoveryeducation.com/WordSearchSetupForm.asp 1 Prinditavate õppematerjalide koostamine veebis Juhendi koostas Margit Lindau Kuidas võõrkeelne tööleht eestikeelseks muuta? Selleks tee veebis koostatud valmis word search aktiivseks (Jälgi, et teed ainult mängu aktiivseks). Tee aktiivsel pinnal parem hiireklõps, vali COPY/KOPEERI Ava tekstitöötlus MS Word, kleebi see lehele: parem hiireklõps, vali PASTE/KLEEBI Saad töölehe vormistada just nii nagu sina seda soovid, lisada ülesandeid, lisada nime ja kuupäeva rea vms. 2 Prind...
Praktiline töö nr 3 Infootsing otsisüsteemides Leidke vastused järgmistele küsimustele. Kirjutage vastused töölehele. Kirjeldage otsingu läbiviimise käiku (otsingukategooriad, otsisõna, piirangud). Viige infootsingud läbi otsisüsteemis Google (http://www.google.ee) ja https://scholar.google.com/ , kasutades erinevaid otsinguvõimalusi ja teenuseid. Võrdluseks kasuta (vähemalt pooltes küsimustes) ka teisi otsimootoreid (nt Bing http://www.bing.com/ ) ja teemakatalooge (Yahoo: https://www.yahoo.com/ ), metaotsisüsteeme nt Dogpile http://www.dogpile.com/ ), analüüsige tulemusi – leitud veebilehti ja vastuseid, tulemuste relevantsust. Oluline on otsingu läbiviimise kirjeldus! 1. Leidke üliõpilastööde vormistamise .pdf formaadis juhend, mida on uuendatud viimase aasta jooksul. Esitage kirje. Kuidas otsingu lä...
Praktiline töö nr 4 Otsing andmebaasides Leidke vastused järgmistele küsimustele. Hinnake leitud dokumente ning esitage sisuliselt vastav tulemus. Kirjutage vastused töölehele. Kirjeldage otsingu läbiviimise käiku (otsingukategooriad, otsisõnad, piirangud). 1.-3. küsimusele leidke vastus Open Access andmebaasist (http://www.doaj.org/) 1. Leidke artikleid infokirjaoskuse kohta kõrgkoolides. Esitage ühe artikli kirje. Kuidas otsingu läbi viite? Inglise keeles! Advanced search, ,,information literacy" key word, ,,university" key word. Noriega, E F. (2011). Biblioteca y docencia : motivando el desarrollo de un programa ALFIN en el Consorcio de Universidades. Alexandría : Revista de Ciencias de la Información, 5, (8), 54-68 2. Leidke artikkel, ...
Bioinformaatika ülesanded Järjestuste võrdlemine, otsingud andmebaasidest (BLAST, FASTA, SW). 1. BLAST programmide kasutamine tundmatu valgujärjestuse identifitseerimiseks või sarnaste valgujärjestuste leidmiseks (http://www.ncbi.nlm.nih.gov/BLAST/). Programmide kasutamisel tutvuda tutorialite ja juhenditega!!! (http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/information3.html). a. Otsida sarnaseid järjestusi antud valgujärjestusele. Valida sobiv programm vastavalt NCBI juhendile valgujärjestuse võrdlemiseks valgujärjestuste seast. Valida otsimiseks Refseq andmebaas, sooritada otsing, tulemuste formaat 500 joondamise jaoks. GTESPLLTDPSTPNFFWLAWQARDFMSKKYGQPVPDRAVSLAINSRTGRTQNHFHIHISCIRPDVRKQLDNNLAN ISSRWLPLPGGLRGHEYLARRVTESELVQRSPFMMLAEEVPEAREHMGRYGLAMVRQSDNSFVLLATQRNLLTLN RASAEEIQDHQCEILRMRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEM...
Canada Aboriginal people, First Nations and Inuit Eneli Maltsar Form 9 8th December 2017 Canada Canada is a country in the nothern part of North America The capital of Canada is Ottawa The population of Canada is 36 million Total area is 9,984,670 square kilometres (3,855,100 square miles) The largest city is Toronto Canada Canada is a bilingual country : they speak both English and French The monarch is the Queen of England It's ten provinces and three territories extend Canada's national anthem is `' O Canada '' How Canada got it's name? Canada's name comes from `' kanata, '' the Iroquois-Huron word for `' village '' or `' settlement '' Aboriginal people, First Nations and Inuit Aboriginal Canadians, also known as Indigenous Canadians, are the indigenous people within the boundaries of present - day Canada. The first largest group were the Indians. Nowad...
Tööriistaribal on palju nuppe ja kõik on erinevate funksioonidega. alustades vasakult leiame nupud: new blank document avabuue ja puhta lehe wordis open- failide avamiseks save-salvestamiseks e-mail-saab saata selle dokumendi e-mail aadressile search-otsimiseks print-saab printida välja käesoleva dokumendi print perview-saab vaadata printimise eelvaadet spelling and grammar- cut-saab välja lõigata vajaliku lõigu copy- saab kopeerida vajaliku lõigu paste- saab kleepida kopeeritud või lõigatud lõigu format painter undo typing-saab võtta tagasi tehtud toiminguid cant redo- vastupidine undo typing-le insert - saab tekitada lingi teise faili juurde minemiseks tables and borders- saab tekitada ruudustiku insert table- saab tekitada tabeli insert microsoft exel worksheet-saab tekitada microsoft exel-i tabeli columns- saab tekitada koopiaid juba kirjutatust samale lehele drawing-tekitab alla äärde joonistusriba dokument map show/hid...
What I Think of Homereading? I think that homereading is important and a good way to educate. Finding a good book to read is not only interesting entertainment but a good way to learn. I think that homereading is necessary for those who want to learn English. Everyone should read books if they have free time. Reading is one of the best things to do in your free time. It is very exciting to read a good book. There are many categories of books: fantasy, romantic, fiction, nonfiction, action, adventure, historical, children's and teen's books, biography, educating books, cooking books. The genre of the book depends what the reader likes to read about. I think that everyone can find something interesting for themselves, they just need to search. These days it is easy to find books, the library is full of books and there are many webpages where reader can read e-books online. Reading is not only fun ...
1. Tarkvara erinevad liigid Tarkvara jaotatakse kahte põhiklassi: · Süsteemitarkvara on vajalik arvutiriistvara ja arvutisüsteemi toimimiseks. Süsteemitarkvara alla kuuluvad operatsioonisüsteemid, seadmete draiverid, serveritarkvara, aknahaldustarkvara jm. · Rakendustarkvara võimaldab kasutajal teatava kindla ülesande täitmist. Rakendustarkvara alla kuuluvad näiteks kontoritarkvara, arhiveerimistarkvara, majandustarkvara, andmebaasid, arvutimängud. Rakendustarkvaras on tavaliselt kasutusel graafiline kasutajaliides (GUI). Üldiselt mõistetakse tarkvara all kõiki programme arvutis. 1.1 Rakendustarkvara Rakendustarkvaraks on programmid, mida tavakasutaja mingi konkreetse töö tegemisel kasutab. Näiteks tekstitoimetid (Microsoft Word), esitluste tegemiseks mõeldud programmid (Microsoft PowerPoint), tabelarvutusprogrammid (Microsoft Excel), andmebaasisüsteemid (Access), joonistamispro...
Ireland and the UK AnneMai Runtal Ireland and UK UK (United Kingdom) Ireland • Capital: Dublin • Capital: London • Area: 70,282 square kilometres • Area: 243,610 square kilometres • Population: 3.8 million • Population: 63,181,775 • Offical lagunges: Irish, English • Offical lagunges: English • National symbol: the shamrock • National symbol: The Eagle Ireland and UK Ireland And UK Differents • Ireland is a big island to the west of great Britain.England is a country on Great Britain. • Irelandeuro, UKdollar • There is a greater proportion of Catholics in Ireland than in England. • England is ruled by a Monarch, Ireland is a Republic. Common • Travel area • Lagunge • Time Ireland intresting facts • Ireland has wo...
Nimi:ANNERIIN TRUU Õpperühm:IK 12 Praktiline töö nr. 6: Interneti otsimootorite kasutamisvõimalused Järgnevatele küsimustele vastates kasutage Google’t. Lisaks tulemusele pange kirja, millist otsinguviisi kasutasite ja millise päringu sõnastasite. 1. Leidke .edu domeeniga veebilehtedelt materjale, mis räägivad tsensuurist Nõukogude Liidus. Kui palju ja mida leiate? Kasutasin - Google Advanced Search-i this exact word or phrase: tsensuur nõukogude liidus language:estonia site or domain: .edu leidsin 10 aga kaks neist oli mingil määral väga kahtlase sisuga saidid. Igatahes leidsin resümeid, artikleid ja teavikuid mis räägivad Nõukogude Liidust ja tsensuurist(ajalool põhinevad) 2. Leidke korteriühistu Rannaääre aastaaruandeid, mis on eestikeelsed ja PDF formaadis. Kui palju ja mida leiate? Leidsin 5 2010.majandusaasta aruanne.pdf - Korteriühistu Rannaääre www.rannaaare.ee/.../2010_majandusaasta_aruanne....
Are IT and communication technology bringing about more positive or negative changes? Dear audience, i want to tell you about the positive and negative sides of it and communication technology. Informational technology is most commonly used to talk about computers and computer networks but it also includes other information sorces such as television and telephones. Electronic computers began to appear in the early 1940's. The origins of the internet are from the 1960's. Over a third of the human's population have used the services of the internet. But what about the other two thirds? Is is better for them to have not been able to use this huge network, or is it a bad thing? The first biggest concerns are the communication sites because they are used too often and they tend to change the view how we understand the term ,,personal relationships". The most popular social network-Facebook-was launched in 2004 and it has beco...
The Internet The Internet Positive Sides of Internet: Easy To Get Information Easy To Communicate With Your Friends Easy To Do Everyday Chores Negative Sides of Internet: There Are Dangerous People on Internet There May Be Information About You There Are Many Viruses That Can Harm Your Computer The Internet Easy To Get Information You can read news from the Internet, make researches, find pictures and a lot of useful stuff on the Internet. The best part of Internet is that it is free. Newspaper costs money, but you can read news from computer for free. Also you can use the dictionary for example, it's fast and easy to use. A lot easier to search the word from a book. The Internet Easy To Communicate With Your Friends Many teenagers go to chat rooms after school, to talk with friends and even make new friends. In USA, many people even get married on the Internet. ...
An analysis of the problem of Political Power Written by: Katre Kikkas Introduction It is said that in the political philosophy there are only two questions: ,,Who can have what?" and ,,Who will decide over it?". It is not exactly like that but it is quite close to the trough, to begin with. The first question includes material amenity's, and dividing rights and liberties.(Wolff, 1996) What is power? It is ability to influence others to do something they otherwise would not. Also, others can be affected with threats and force. (Kilp, 2010) Political power includes also right to force the others and to punish them if they disobey. Who should have that kind of power? Actually the political power is quite mysterious by itself. If someone has legitimate political power over me then he or she has a right to force me to do things that they want.(Wolff, 1996) But how can other person have rig...
LEXICOLOGY 1. Size of English vocabulary 1) Old English – 50,000 to 60,000 words Vocabulary of Shakespeare OE – homogeneous; 1/3 of the vocabulary has survived • 884,647 words of running text About 450 Latin loans (Amosova) • 29,000 different words (incl. work, working, Viking invasions added 2,000 worked, which are counted here as separate 2) Middle English – 100,000 – 125,000 words) English becomes heterogeneous (Norman French, • 21,000 words English, Latin), hybrid of Germanic and Romance languages Norman French influence – about 10,000 words, 75 % are still in use (Baugh) Latin influence continues 3) Early Modern English – 200,000 – 250,000 English becomes a polycentric language; polyglot, cosmopolitan lang...
Creole Culture Report Table of contents INTRODUCTION.........................................................................................................................................................2 FAMILY LIFE..............................................................................................................................................................3 HISTORICAL CREOLE GENDER ROLE...............................................................................................................4 CREOLE CUSTOMS.......................................................................................................................................................5 CREOLE CULTURE...................................................................................................................................................5 PEOPLE.......................
Albert Einstein Albert Einstein was a Germanborn theoretical physicist. Einstein is often regarded as the father of modern physics. Einstein published more than 300 scientific papers. His great intelligence and originality has made the word "Einstein" synonymous with genius. Early life Albert Einstein was born in Ulm, but the family moved to Munich in 1880. Albert attended a Catholic elementary school from the age of five until ten. In 1894, his father's company failed and in search of business, the family moved to Italy. Einstein wrote his first scientific work, "The Investigation of the State of Aether in Magnetic...
Praktiline töö nr 3 Otsing andmebaasides Leidke vastused järgmistele küsimustele. Hinnake leitud dokumente ning esitage sisuliselt vastav tulemus. Kirjutage vastused töölehele. Kirjeldage otsingu läbiviimise käiku (otsingukategooriad, otsisõnad, piirangud). 1.3. küsimusele leidke vastus Open Access andmebaasist (http://www.doaj.org/), 4.6. küsimusele andmebaasist Emerald (http://www.emeraldinsight.com/Insight/), 7.9. küsimusele andmebaasist EbscoHost (http://search.epnet.com), 10.15. küsimusele RRi andmebaasist ISE (http://ise.nlib.ee). 1. Leidke artikleid infokirjaoskuse kohta kõrgkoolis. Esitage ühe artikli kirje. Kuidas otsingu läbi viite? Võtan Find Article otsingu. Kirjutan esimesse kasti information literacy ning teiselahtrisse university, alumisele kasti...
1. Kui palju Tallinna Linnaarhiivis leiduvaid inkunaableid on kajastatud Briti Raamatukogu inkunaablite andmebaasis? http://istc.bl.uk/search/index.html otsisin siit Tallinna järgi otsides andis 70 vastet. Panin aga tähele, et mõnede taha oli kirjutatud ,,Tallinn arch" ja mõnede ,,Tallinn acad" Eeldasin, et arch tähistabki linnaarhiivi, acad aga akadeemilist raamatukogu. Seega vaatasin veel siit http://istc.bl.uk/search/browse.html? operation=scan&numreq=25&fieldidx1=norzig.posessingInstitution&fieldrel1=exact&fieldco nt1=Tallinn ning pakun, et Linnaarhiivis olevaid inkunaablid on seal andmebaasis kajastatud 21, mitte 70 tallinn arch 18 tallinn arch (imperfect) 3 2. Mitu 1468. aastal trükitud inkunaablit on kirjeldatud Baieri Riigiraamatukogu inkunaablite a ndmebaasis? Esita vastuses nende identifikats...
1. What does the word “philosophy” mean? The study of proper behaviour and the search for wisdom, in greek means love for wisdom 2. Is philosophy a science? Why? What kind of science it is? Yes it is. It tries to understand the meaning of reality. It’s the science of truth. Science, as it exists today, happens within the framework of philosophy. Philosophy, however, is bigger than science. It is also a form of art and discipline…... 3. Name three characteristics of Classical philosophy? deeply rooted in religious traditions ; believes that inferior was created by superior ; more positive ; seeks the real truth ; about intelligence ; reaalsuse üle mõtisklus ; believes that god is truth 4. Name three characteristics of Modern philosophy. believes that superior was created by inferior (!) ; more negative ; about will ; power ; domain of reality ; believes that knowledge is truth ; man is god 5. What was the problem that the first philo...
1.Lexicology as a science L. studies the voc of lg as a system. Word-learning, lexis-logos. The task of L is to establish the general features of modern Engl voc. Theoretical L. gives a complete picture of voc. Practical value lies in using and appretiating the lg more conciously. There is diachronic (historical) L that studies origin and development; syncronic studies voc at a given historical period. There are general L (studies words disregarding particular features of any particular lg); special L (studies specific features of a separate lg, there is Engl that bases on general L); contrastive (compares vocabularys in different languages). 2. Connection of L with other linguistic disciplines a) the word performes a certain grammatical function (nt, he always misses the class, how many misses are there; the girl powders her nose, soliders face powder)In speech words are combined according to grammatical rules. The plural of nouns m...
TARTU ÜLIKOOL Pärnu kolledz Ettevõtluse osakond GOOGLE DOCS Referaat Juhendaja: Taavi Tamberg Pärnu 2009 SISUKORD SISSEJUHATUS...............................................................................................................3 1.TARKVARA OMADUSED.......................................................................................... 4 2.TARKVARA RAKENDAMINE................................................................................... 7 KOKKUVÕTE..................................................................................................................9 KASUTATUD KIRJANDUS..........................................................................................10 LISAD............................................................................................................................. 11 Lisa 1 Üldine informatsioon............................................................
Cat. No. W317-E1-11 SYSMAC CPM1A Programmable Controllers OPERATION MANUAL CPM1A Programmable Controllers Operation Manual Revised October 2007 iv Notice: OMRON products are manufactured for use according to proper procedures by a qualified operator and only for the purposes described in this manual. The following conventions are used to indicate and classify precautions in this manual. Always heed the information provided with them. Failure to heed precautions can result in injury to people or dam- age to property. ! DANGER Indicates an imminently hazardous situation which, if not avoided, will result in death or serious injury. Additionally, there may be severe property damage. ! WARNING Indicates a potentially hazardous situation which, if not avoided, could re...
Eesti Ettevõtluskõrgkool Mainor TEKSTIDOKUMENDI LOOMINE WORD 2010 (2007) ABIL Infotöötluse loengukonspekt Kalev Avi, MSc Tartu 2011 SISUKORD Kiirklahvid .....................................................................................................................................................3 Funktsionaalklahvid .......................................................................................................................................5 Sissejuhatus ....................................................................................................................................................6 Wordi dokumendi struktuur ...........................................................................................................................7 MS Wordi ekraanipilt .................................................................................
20. sajandi I poole peamised kunstivoolud Laialt levinud arvamuse kohaselt koosnevad kunst ja selle ajalugu üksikteostest.Mitte ainult iga kunstnik, vaid ka iga teos on unikaalne,kordumatu. ( ,, 20. Sajandi kunst " A. Juske , J. Kangilaski , R. Varblane ) Inimeste elutingimused on viimase saja aasta jooksul muutunud märgatava kiirusega,nii samuti on toimunud suured muutused ka kunstis. Kunst arenes tormiliselt ning muutus 50 aasta jooksul nii palju, kui seda oli enne teinud pea neljasaja aasta jooksul. 20. sajand on kunstiajaloos justkui omamoodi revolutsiooniline murdepunkt. (http://www.miksike.ee/docs/referaadid2005/20sajipoole_kunstivoolud_mariliisneubauer.htm ) 20. sajandi alguseks oli uuenduslik, nn. moodsa kunsti ühiskondlik seisund paranenud. Sajandivahetuse kunsti mitmesuunalisus oli publikut harjutanud stiilide ja laadide pluralismiga.Kriis ametlikus kunstis oli kõigutanud usku ,, igavestesse reeglites...
Seediscussions,stats,andauthorprofilesforthispublicationat:https://www.researchgate.net/publication/280905030 Subtitlereadingspeed:Anewtoolforits estimation ArticleinBabel·January2014 DOI:10.1075/babel.59.4.02mar CITATIONS READS 3 179 1author: JoséLuisMartíFerriol UniversitatJaumeI 13PUBLICATIONS18CITATIONS SEEPROFILE Someoftheauthorsofthispublicationarealsoworkingontheserelatedprojects: Inclusiónsocial,traducciónaudiovisualycomunicaciónaudiovisual(ÍTACA)Viewproject AllcontentfollowingthispagewasuploadedbyJoséLuisMartíFerriolon13October2017. Theuserhasrequestedenhancementofthedownloadedfile. John Benjamins Publishing Company This is a contribution from Babel 59 : 4 © 2013. All rights reserved. This electronic file may not be altered in any w...
A Modern Answer to the Commune By: Penelope Green Johanna Bronk wants to make communal vegetarian meals and keep chickens. Mariel Berger hopes for social, artistic and political collaborations. Harmony Hazard is into hula hooping, book groups and anarchism. Oh, to be a young city-dweller in search of a house share. Finding a roommate has never been easy, but for some, the endeavor has lately assumed all the urgency, emotion and extreme specificity of shopping for a life partner. Last month, just in time for leases to turn over, the housing portion of Craigslist, the uber-community bulletin board and road map to the 20-something's psyche, featured dozens of impassioned tone poems, vivid personal biographies and ideological wish lists. Unfettered by space restrictions -- since Craigslist is free and space on the Internet is boundless, the word count of housing posts can stretch into the thousands, and some do -- and...
WORD FORMATION Exercise I 1. Chestnut honey provides quick and ............. relief.(EFFECT) 2. Come rain, wind or shine these snapdragons give a superb display over an ....................... long period. (EXCEPTION) 3. Dreaming of a beautiful home for your ........................... .(RETIRE)? Enjoy lifetime ownership of a luxury home for an ................. price.(AFFORD) 4. The post-war decline in beer ......................... was practically halted last year. (CONSUME) 5. Better is a dinner of herbs where love is, than a stalled ox and ..................therewith.(HATE) 6. In the first quarter of the 18th century people began to realise the ......................... of hygiene to public health.(IMPORTANT) 7. The ....................collapse of the Roman Empire lasted for nearly three hundred years before its final dissolution in AD 476.(GRADE) 8. Jamie's ....................of the night's events is hazy but the tabloids will re...
English lexicology 1. Size of English vocabulary Vocabulary is a sum total of words used in a language by speakers or for dictionary-making. Active and passive vocabulary. The Old English vocabulary was homogenous. There were about 50 000 – 60 000 words, 1/3 of which have survived. o About 450 loans from Latin o About 2000 from the Viking invasions. The Middle-English vocabulary became a heterogeneous hybrid of Germanic and Romanic languages. 100 000 to 125 000 words. o About 10 000 loans from Norman French, 75% are still in use o Continuing Latin influence Early Modern English. 200 000 – 250 000 words o English becomes a pluricentric language. o Polyglot. Cosmopolitan language Modern English. 500 000 words o At present at least 1 billion lexical units 2....
JOHNNY CASH Semester Powerpoint By: Nicole Casaday Biography Walking a Line in His Shoes February 26, 1932 in Kingsland, Arkansas; the one and only Johnny Cash was brought into a loving family of nine created by Ray and Carrie Rivers Cash. Johnny and his family lived In Kingsland until he was at the age of three, where they then moved to Dyess, Arkansas; a Colony in Northeast Arkansas. The Cash family farmed nearly 20 acres filled of cotton, there Ray, Kerry and all seven of their children worked side by side in the crops; including little Johnny. Johnny as a Kid... Cash spent his childhood in Guns & Girls Dyess Colony until he graduated high school in 1950, where he then fled off to D e t r o i t in search of work only to find himself in Pontiac, Michigan working in the automotive business. However, Cash soon after enlisted in the U.S. Air Force and was sent off to basic training in Te x a s . While ...
Idealization of Nature in Romantic Poetry One of the main characteristics of romanticism in general is the constant praising of nature and connecting it with almost everything. As the second half of the 18 th century was the time of the industrial revolution, urbanization and mankind's distancing from nature in every way, it is not surprising that as a result it became more and more important to and valued by people it had suddenly become something remote and far from everyday life, somewhat a luxury. The utmost way this luxury manifests in romantic poetry is nature's ability to help whoever takes the time to value its divinity get in touch with themselves and get away from everything that might influence their way of acting. Nature provides the ideal atmosphere and surroundings to do this in the opinion of romantic poets, it is the very best place to come to when in need of solitude or an answer to personal or social conflicts....
Facebook is a social networking service, which was launched in February 2004. It is owned and operated by Facebook Inc. In September 2012 Facebook had over billion active users and more than half of them were also using Facebook on a mobile device. Facebook's latest research shows that the most popular mobile device used for visiting m.facebook.com is iOS and by the popularity the second most used device is Android. Using Facebook on your mobile device raises the potential of your account getting stealed. It is so because most of the users don't use safe connection so all your data is available to other users on the same network. So the very first thing you should do is to use safe connection by adding to the end of this word ,,http://" (which you can find in the beginning of every webpage) an ,,s" so the address should be like ,,https://". The second thing you can do is that if you own the Wi-Fi access point then you should definately...
MARTIN POLD 12 Carlisle Street, Leicester, LE3 6AF Mobile: 07762877920 E-mail: [email protected] PERSONAL PROFILE: I am highly motivated person currently running my own small businesses. I have over 10 years experience in customer service setting, enabling me to develop high levels of communication and attention to detail. I am reliable and responsible having previously been entrusted with cash handling and dealing with financial transactions. I also have experience of training other members of staff. KEY SKILLS: Excellent communication and customer service skills Excellent IT skills Accurate and numerate Can work well as part of a team or own initiative Highly motivated and enthusiastic Flexible and adaptable Language skills: Estonian, English, German, Russian, Latin EMPLOYMENT HISTORY: Student Check-In Helper, Pertemps, Sep 2018 Duties: Working for Unite Students, helping to park over 600 cars over 3 days...
EXCEL – Funktsioonid 1 - 11 Sisukord 1 Matemaatilised ja trigonomeetrilised funktsioonid.....................................................................................................2 2 Kuupäeva ja kellaaja funktsioonid...............................................................................................................................2 3 Statistilised funktsioonid..............................................................................................................................................3 4 Tekstifunktsioonid.........................................................................................................................................................3 5 Loogilised funktsioonid....................
CHAPTER 1 GETTING TO KNOW THE TOEFL WHAT IS THE TOEFL? The TOEFL is a comprehensive English language examination required by more than 3,000 colleges and universities in the United States, Canada, and other parts of the world. In addition, foreign born professionals frequently need a TOEFL score for certification to practice their profession in the United States or Canada. The TOEFL is a timed test that consists of the three sections listed here. THE TOEFL Section 1 Listening Comprehension 50 questions 35 minutes Part A Statements 20 questions Part B Short Dialogs 15 questions ...
The Life of Dante, the Inferno of Dante Dante Alighieri, one of the greatest poets of the Middle Ages, was born in Florence, Italy on June 5, 1265. He was born to a middle-class Florentine family. At an early age he began to write poetry and became fascinated with lyrics. During his adolescence, Dante fell in love with a beautiful girl named Beatrice Portinari. He saw her only twice but she provided much inspiration for his literary masterpieces. Her death at a young age left him grief-stricken. His first book, La Vita Nuova, was written about her. Sometime before 1294, Dante married Gemma Donati. They had four children. Dante was active in the political and military life of Florence. He entered the army as a youth and held several important positions in the Florence government during the 1290's. During his life, Florence was divided politically between Guelphs and Ghibellines. The Guelphs supported the church and liked to keep thi...
Rudyard Kipling - One of the most memorable English writers of all time Family of Joseph Rudyard Kipling Mother- Alice MacDonald Kipling. Alice Kipling (one of four remarkable Victorian sisters) was a vivacious woman about whom a future Viceroy of India would say, "Dullness and Mrs. Kipling cannot exist in the same room."[3] Father - John Lockwood Kipling. Lockwood Kipling, a sculptor, an illustrator, museum curator and pottery designer, was the principal and professor of architectural sculpture at the newly- founded Sir Jamsetjee Jeejeebhoy School of Art and Industry in Bombay. Later in life Kipling illustrated many of Rudyard Kipling's books, and other works. Kipling also remained editor of the Journal of Indian Art and Industry, which carried drawing works from the students of the Mayo School. COUPLE named their son after the place they had first met Rudyard Lake. Alice Kipling Fleming - Sister of British author Rudyard Kipling w...
Meetod (alamprogramm) Java rakendus sisaldab põhiprogrammi (main), millest tõenäoliselt pöördutakse ka mingite alamprogrammide poole. Javas nimetatakse alamprogramme meetoditeks (tulenevalt selle keele objektorienteeritusest) ning meetodid on rühmitatud klasside kaupa. Meetodid võivad olla kas programmeerija enda poolt loodud või Javasse sisse ehitatud (nn. API meetodid, mille kirjelduse leiab Java dokumentatsioonist). Sõltumata sellest, kust meetod pärineb, võib see olla kas klassi- või isendimeetod. Klassimeetod (class method) , mida Javas kirjeldab võtmesõna static, on kasutatav n.ö. "igas olukorras", s.t. ei ole vajalik objektorienteeritud paradigma järgimine (esialgu püüame oma kursuses läbi ajada klassimeetoditega). Täpsemalt öeldes - klassimeetodi poole pöördumiseks ei ole vajalik objekti olemasolu. Klassimeetodi poole pöördumiseks kirjutatakse reeglina: Klassi_nimi . meetodi_nimi ( faktilised_parameetrid ); Kui meetod on define...
Wiz Khalifa Nimi klass Background information Cameron Jibril Thomaz better known by the stage name Wiz Khalifa, is an American rapper. He released his debut album, Show and Prove, in 2006, and signed to Warner Bros. Records in 2007. His euro dance-influenced single, "Say Yeah", received urban radio airplay, charting on the Rhythmic Top 40 and Hot Rap Tracks charts in 2008.Khalifa parted with Warner Bros. and released his second album, Deal or No Deal, in November 2009. He released the mixtape Kush and Orange Juice as a free download in April 2010; he then signed with Atlantic Records.He is also well known for his debut single for Atlantic, "Black and Yellow", which peaked at number 1 on the Billboard Hot 100. His debut album for the label, Rolling Papers, was released on March 29, 2011. About him Wiz Khalifa was born on September 8, 1987 to a mother and a father serving in the military. His parents divorced when K...
Philosophy Aristotle - four causes or better "becauses" because they are the 4 ways in which we use the word "because" or answer the question "why?" 1. Material cause: - what it is made of - why is the bridge strong? because made of steel 2. Formal cause: - what form, definition or property it has - why is this salt? because made of sodium and chloride 3. Efficient cause: - what initiated the change or movement - why did the baseball move? because someone hit it 4. Final cause: - what end or goal does it have? - why does he walk? because he wants to be healthy - also nature operates in terms of final causes - things don't happen spontaneously, every action that nature takes is for the sake of something, everything has a p...
A... AA Auto Answer AAA Authentication, Authorization and Accounting AAB All-to-All Broadcast AAC Advanced Audio Coding AACS Advanced Access Control System AAL Asynchronous Transfer Mode Adaption Layer AAM Automatic Acoustic Management AAP Applications Access Point [DEC] AARP AppleTalk Address Resolution Protocol AAS All-to-All Scatter AASP ASCII Asynchronous Support Package AAT Average Access Time AATP Authorized Academic Training Program [Microsoft] .ABA Address Book Archive (file name extension) [Palm] ABAP Advanced Business Application Programming [SAP] ABC * Atanasoff-Berry Computer (First digital calculating machine that used vacuum tubes) ABEND Abnormal End ABI Application Binary Interface ABIOS Advanced BIOS ABIST Automatic Built-In Self-Test [IBM] ABLE Adaptive Battery Life Extender + Agent Building and Learning Environment [IBM] ABM Asynchronous Balanc...
TARTUFFE A COMEDY CHARACTERS MADAME PERNELLE, mother of Orgon ORGON, husband of Elmire ELMIRE, wife of Orgon DAMIS, son of Orgon MARIANE, daughter of Orgon, in love with Valere CLEANTE, brother-in-law of Orgon TARTUFFE, a hypocrite DORINE, Mariane's maid M. LOYAL, a bailiff A Police Officer FLIPOTTE, Madame Pernelle's servant The Scene is at Paris ACT I SCENE I MADAME PERNELLE and FLIPOTTE, her servant; ELMIRE, MARIANE, CLEANTE, DAMIS, DORINE MADAME PERNELLE Come, come, Flipotte, and let me get away. ELMIRE You hurry so, I hardly can attend you. MADAME PERNELLE Then don't, my daughter-in law. Stay where you are. I can dispense with your polite attentions. ELMIRE We're only paying what is due you, mother. Why must you go away in such a hurry? MADAME PERNELLE Because I can't endure your carryings-on, And no one takes the slightest pains to please me. I leave your hou...
Homereading 4 Changing world Religions Islam Islam is a monotheistic Abrahamic religion originating with the teachings of Muhammad, a 7th century Arab religious and political figure. The word Islam means "submission", or the total surrender of oneself to God An adherent of Islam is known as a Muslim, meaning "one who submits (to God)". There are between 1.1 billion and 1.8 billion Muslims, making Islam the secondlargest religion in the world, after Christianity. Muslims believe that God revealed the Qur'an to Muhammad, God's final prophet, and regard the Qur'an and the Sunnah (words and deeds of Muhammad) as the fundamental sources of Islam.They do not regard Muhammad as the founder of a new religion, but as the restorer of the original monotheistic faith of Abraham, Moses, Jesus, and other prophets. Islamic tradition holds t...
What is the real meaning of life? Why prefer one thing to another? Can we trust observation? It’s raining outside - how do you know it is? I can see it’s raining. How to convince yourself its raining? A good reason to doubt - 49 other peaople have the same opinion. Falsifiable → possible; not falsified World disappeared in 2012 and got recreated 3 secs later → unfalsifiable - cannot prove it’s true/wrong, cannot provide any tests to prove it. Or - one or another but not both → exclusive - one or another (both) → inclusive (Invited those who are managers or specialists - both) Arguments valid or not - logic is a science where to decide it Different arguments lead to different methods. 1 - Recognizing arguments What is an argument? An argument is a group of statements, so that one or more of them (called the premises) is said to provide support for one of the others (called the conclusion). When the course sta...
Tallinna Inglise Kolledz Australia Topic Alice Tärk, 8b. Tallinn 2007 Table of contents: Factfile............................................................................................. ................................. Symbols.......................................................................................... ....................................Head of State................................................................................................ ................... Government....................................................................................... ............................... History............................................................................................. .................................. Relief..................................................................................................
Bad Teacher Elizabeth Halsey (Cameron Diaz) is a Chicago middle school teacher at the fictional John Adams Middle School who curses at her students, consumes lots of alcohol, smokes marijuana, and only shows movies while she sleeps through class. She plans to quit teaching and marry her wealthy fiancé, but when he dumps her, she must resume her job as a teacher. She tries to win over substitute teacher Scott Delacorte (Justin Timberlake), who is also wealthy. Amy Squirrel (Lucy Punch), a dedicated teacher and colleague of Elizabeth, also pursues Scott while the school's gym teacher, Russell Gettis (Jason Segel), makes advances on Elizabeth which she rejects.[3] Elizabeth plans to get surgery to enlarge her breasts, believing she is being overlooked for women with larger chests. However, she cannot afford the $10,000 procedure. To make matters worse, Scott admits that he has a crush on Amy, only viewing Elizabeth as a friend. Elizabeth...
Sissejuhatus integreeritud turunduskommunikatsiooni (IMC) Turundusmeetmestik (marketing mix) – nende abil jõutakse kliendini 4P-d Product Price Place Promotion (info viimine kliendini) Selle mudeli probleem: Ei kasutatud ära kõiki võimalikke viise klienditega suhtlemisel ITK on kanali suhtes neutraalne- mis iganes kommunikatsioon, mis on mõeldud selleks, et müüa klientide abil oma toode või idee Organisatsioonikommunikatsioon- üks osa on turunduskommunikatsioon. On mõeldud klientide mõjutamiseks, ehk raha sisse toomiseks Kommunikatsiooniprotsess Saatja sõnum meedia vastuvõtja (kes – mida ütleb – kus – kellele – mis mõjuga) Kommunikatsiooni mudel MÜRA (raskus sõnumi vastuvõtmisel, nt inimene räägib, sina oled telefonis, eelmises loengus kuulsid midagi, mis on vastuolus hetkel räägitavaga) TAGASISIDE (vastus, abi, tunnustus). Saatja saab infot, kas tema sõnum mõjus, jõudis pärale, mil viisi...
Introduction, Location Australia is a country between the Indian Ocean and the Pacific Ocean. It is the only country in the world that occupies an entire continent. The mainland covers an area of 7.7 million km² and it is about 3700 km from the most northern point to its most southern point and about 4000 km from east to west. There are also many different seas around Australia, like the Coral and the Tasman Seas in the west or the Timor and the Arafura Seas in the north, where the Indian and the Pacific Oceans meet. Because all seas and oceans near Australia are warm, surfing is a very popular hobby. Political subdivision Australia is divided into six states, which are: · New South Wales · Victoria · Queensland · South Australia · Western Australia · Tasmania New South Wales is the most populous state in Australia. Its capital is Sydney. Victoria is one of the most densely populated states in Australia. Its capit...
Viljandi County Gymnasium Prepositions Name Form 11b Supervisor: Name Viljandi 2009 Viljandi County Gymnasium 1. Prepositions of place The ball is in the box The ball is on the box. The ball is under the box. Jane's house Bill's house John's house John's house is next to Jane's Jane's house is between Bill's Bill's house is next to Jane's house. and John's houses. house. The man stood The climbers The man stood The enemies stood The gardners next to the gopher stood on top of between the two opposite each stood behind the ...
Tallinna Inglise Kolledž Australia Referaat Tallinn Table of contents: Introduction.....................................................................................................................3 Geographical Position.....................................................................................................3 Relief...............................................................................................................................4 Climate & Time Zones....................................................................................................5 Plants...............................................................................................................................5 Animals...........................................................................................................................6 Population........................................
annaabi.ee 
