Vajad kellegagi rääkida?
Küsi julgelt abi LasteAbi
Logi sisse
Sulge

"will smith" - 108 õppematerjali

Will Smith
8
doc

Will Smith

Will Smith Referaat Tegija: Rasmus Roos Juhendaja: Mariana Kellner Sissejuhatus Will Smith, sünninimega Willard Christopher Smith Jr., sündis külmutusfirma asutaja peres teise lapsena. Ta on sündinud 25.09.1968 Philadelphia, Pennsylvania, USA. Kaheksakümnendate teisel poolel astus ta avalikkuse ette muusikuna koos DJ Jazzy Jeff'iga. Smithi lavanimeks oli sel ajal "The Fresh Prince". Sõna Prince panid talle hüüdnimeks lapsepõlvesõbrad, kuna tal õnnestus alati pahandustest puhtana välja tulla. 1992. aastal alustas ta filminäitleja karjääri filmis"Where the Day Takes You". Koos Martin Lawrence'ga suutis ta saada suurema tuntuse filmis "Pahad poisid". Kuid erilist tähelepanu peaks pöörama hoopis tema järgmisele filmile - "Iseseisvuspäev" see on 2004. aasta oktoobri seisuga Maailma kõigi aegade kassaedetabelis 11. kohal ning just tänu sellele filmile paljud Will Smithi tunnevadki. Li...

Filmikunst → Ameerika filmi ajalugu
2 allalaadimist
Seven pounds
1
docx

Seven pounds

Film review Seven pounds The film ,,Seven pounds" is a drama about a man named Ben, who changes the lives of seven people. Will Smith plays the main character Tim Thomas, who's under the identity of Ben Thomas. The film was released in 2008. Tim Thomas causes a car crash. Seven people died. Because of that, Tim decides to save the lives of seven good people, who deserve being alive. He donates a lung lobe to his brother, a liver to a child services worker Holly, a kidney to a junior hockey coach, bone marrow to a young boy Nicholas. He also helpes a woman who lives with an abusive boyfriend. Tim gives Connie and her kids his beach house. He also finds a blind meat salesman who plays the piano and a selfemployed greeting card printer who has a heart condition and a rare blood type. One day Tim fills the bathtub with ice water and commits suicide by pulling his box jellyfish into the water. The piano player receives his...

Keeled → Inglise keel
4 allalaadimist
I am Legend
1
docx

I am Legend

I am Legend One of my favorite movies is the film i am legend. Its starring Will Smith as the sole survivor in the dead city of new york. He place a character named Robert Neville who is a doctor. Most of the people have been killed or transformed into monsters who have high speed and superhuman strentgh. They were turned into those monsters by a medicent that was suppose to cure cancer but it did not. Now the doctor is lookeing for a cure to fix that problem and to survive in the destroyd landescape of New York. His wife and son were killed when the military did the extraction of the city. Now he wonders with his dog. Most of the film about 30 min is all calm. Around 40 min mark they chase a deer wich allmost got them killed. The following days they were chased by the strongest of the monsters. The Alpha male who was played by Dash Mihok. Roberts dog gets bitten and infected with the plague while trying to escape from the alpha male ...

Keeled → Inglise keel
2 allalaadimist
The New World kokkuvõte
1
docx

The New World kokkuvõte

The New World The New World is released in December 25, 2005 in the United States and it´s directed by Terrence Malick. Its budget is 30 million $. This is a film full of forbidden love. It has a really beautiful love story which is second most beautiful love story after ,,Titanic". Two main characters are captain John Smith who was a settler from England and he wanted to establish new colonies with his team with three boats and Pocahontas who was later given a name Rebecca. Pocahontas was a local girl who was in an Indian tribe on an island in Virginia. Living among the Native Americans as a prisoner for an extended period, Smith was treated well and earned the friendship and respect of the tribe. Coming to admire this new way of life, he fell deeply in love with Pocahontas. She was intrigued by the Englishman and his ways. But suddenly Smith had to leave because other captain of the English said taht ...

Keeled → Inglise keel
6 allalaadimist
Pennsylvania
28
pptx

Pennsylvania

Pennsylvania Melissa Hein 8.b What? Where? *the 33rd largest *6th most populous *9th most densely populated of the 50 US states *capital is Harrisburgh *Biggest cities are Philadelphia, Pittsburgh,Allentown, Erie, and Reading *Area 119 283 km² Someone famous Actors: Kevin Hart(Philadelphia) Andrew Lawrence (Abington) Will Smith(Philadelphia) Kerr Smith(Exton) joey lawrence(Philadelphia) Something you should know *Amish population *Farmers *Wine *The Drive In cinema Amish population *Pennsylvania Dutch *in the early 18th century, many Amish immigrated to Pennsylvania for a variety of reasons * Christian church fellowships *Total population 290 100 Farmers Roadside stands and indoor and outdoor farmer’s markets are a common sight throughout every county in Pennsylvania.These are the places you will get the most freshest and sweetest fruits and vegetables you’ve ever tasted. Wine Bring a corkscrew because ...

Keeled → Inglise keel
2 allalaadimist
River of Death-Alistair Maclean
4
docx

"River of Death" Alistair Maclean

River of Death Alistair Maclean 1981 Author Alistair (Stuart) MacLean was born in April 28, 1922 and past away February 2, 1987. He was a Scottish novelist who wrote successful thrillers or adventure stories, the best known of which are perhaps "The Guns of Navarone" and "Where Eagles Dare". During World War II he server with the Royal Navy and was a school teacher until 1955. MacLean was awarded a Doctorate of Literature by the University of Glasgow in 1983 Setting: The setting takes place in Brazilian jungle in Amazonas. Characters Colonel Spaatz ­ Nazi wartime criminal Von Manteuffel ­ Nazi wartime criminal, Major-General Hamilton ­Stranger,hes past unknown, Takes crew to Lost city Mr. Smith ­ From an agency, Looks for proof that Lost city exists Silver ­ Helicopter pilot, and good friend to Hamilton later. Maria ­ Heffners girlfriend Jack Tracy ­ Pilot, works with Mr. Smith Navarro ­ Ramons twin brother, Mr. Smi...

Keeled → Inglise keel
15 allalaadimist
Transactional letter
1
docx

Transactional letter

Dear Jane Smith, I am writing behalf of our team to apologize for inconvenience we have caused. It was our fault and we are really sorry about this. Your camera arrived on time, but when we did the checking, we realised that it had been damaged for some reason, so we couldn't send you the damaged camera and due to that we had to wait for the next delivery from suppliers. In order to make the delivery of the new camera faster we decided that, it will be sent as an Express Delivery tomorrow. We assure you that this time you will receive your camera on time. Because of this long delay we want to make it up to you for being a good customer. As a compensation we are going to give you a free carry case and three films as a compensation. For more, your next order will be completely free. We will assure you, that it will not happen again, we sill hope that you will use our services in the future. If you h...

Keeled → Inglise keel
17 allalaadimist
FORMAL LETTER
4
docx

FORMAL LETTER

FORMAL LETTER 120 (+/-10%) words I It is a formal letter. Do not use any contracted forms (don’t, can’t, I’m etc.)! II * Dear Mr. Smith / Dear Ms. Smith (No first name!!!) * Kui teame nime, siis lõpp – Yours sincerely ja ülesandes antud nimi * Kui nime pole öeldud, siis – Dear Sir or Madam * Kui nime ei tea, siis lõpus Yours faithfully ja ülesandes antud nimi Do not use your own name!!! Te olete kas Jürid või Marid, Urved või Urmased jne. Enamasti Mart Mets või Mari Mets TYPES OF LETTERS 1) Asking for advice I am writing to ask if you could help me with … I am writing to ask for your advice … Closing line: I would appreciate if you could give me your advice as soon as possible. I look forward to receiving your advice … 2) Giving advice I am writing in reply to your letter asking advice about …. Making suggestions: I would suggest that ..., I would advise you to … ...

Keeled → Inglise keel
32 allalaadimist
Inglisekeelne report kiri
2
docx

Inglisekeelne report kiri

To: The Aru Secondary Scool library From: Johannes Smith Subject: Schoolmates reading interests Date: 6.10.2015 The purpose of this report is to analyse the results of a recent survey into schoolmates reading habits. In this survey students were asked witch genre of books they like to read. This report is based on a diagram showing the percentage witch genres students like to read. This report will describe the reading habits of The Aru Secondary School. The most popular genre for girls was romantic novels and for boys thrillers. This is shown by fact that girls like more romantic and boys like more suspense. In the survey can read that only 17% girls like to read poetry and only 9% of boys like to read poetry. In conclusion I will say that these results are quite logical outcome. It is been always that girls like more romantic novels and boys thrillers. For summing- up I will say that it is nice that students lik...

Keeled → Inglise keel
28 allalaadimist
California
10
pptx

California

CALIFORNIA POPULATION The United States Census Bureau estimates that the population of California was 38,041,430 on July 1, 2012. LOCATION AND SIZE California is the 3rd largest state in the United States in area, after Alaska and Texas. California is on the west coast of the U.S.A. MAIN SIGHTS Yosemite Valley Alcatraz ­ A prison in the San Francisco city centre. ALCATRAZ FAMOUS PEOPLE Katy Perry ­ an U.S.A pop singer, very famous. Kim Kardashian ­ an U.S.A celebrity Jaden Smith ­ son of Will Smith, an actor Steve Jobs ­ make "Apple computer company". PECULIARITIES Has the biggest population and at the same time one of the biggest crime rates in the U.S One of the best economyes in the U.S, but a very high unemployement rate INTERESTING FACTS California is the USA's most populous state with almost 40,000,000 residents, more than Canada as of 2008. One of eig...

Keeled → Inglise keel
2 allalaadimist
Bastille kontserdi retsensioon
2
docx

Bastille kontserdi retsensioon

Bastille kontserdi retsensioon 6.märtsil käisin ma Bastille kontserdil Saku Suurhallis. Esinesid soojendusartistid NÖEP ja Matt Wills ning peaartist Bastille. Iga artist esitas oma viimaseid ja populaarseimaid teoseid. Nad esitasid vanu ja uusi laule segamini, isegi kui ei teadnud uuemaid laule, siis sai kontserti ikka nautida. Bastille on indie pop bänd, kes on tegutsenud aastast 2010. Bastille liikmed on laulja Dan Smith, klahvpillimängija Kyle Simmons, trummar Chris Wood, kitarrist Will Farquarson ja Charlie Barnes. Grupp sai alguse Dan Smithi sooloprojektist, millele hiljem lisandusid Kyle, Chris ja Will. Kõik bändi liikmed on pärit Inglismaalt. Nad esitasid oma kuulsaimaid laule „Pompeii“ ja „Things we lost in the fire“ kui ka teoseid viimaselt albumilt Wild World nagu näiteks „Send them off“, „Glory“, „Snakes“ jne. Laulja kui ka pillimängijate tase oli väga hea, mingeid vigu ei oska välja tuua. Mulle nende muusika väga meeldi...

Muusika → Popkultuur ja popmuusika
1 allalaadimist
BASTILLE-UK-WILD WORLD TOUR
2
docx

BASTILLE (UK) WILD WORLD TOUR

BASTILLE (UK) WILD WORLD TOUR Briti indie-popbänd Bastille on hetkel oma uue albumi “Wild World” maailmaturneel ning seda käidi 6. märtsil 2017. aastal Saku Suurhallis ka eestlastele tutvustamas. Kontsert hakkas peale kella 21.00, kuid enne seda soojendasid bändi NOËP ja Matt Wills. NOËP on üks mu lemmiklauljaid ning tema oli üks põhjuseid, miks ma sinna kontserdile üldse läksin. NOËP’i kontserdile pole ma varem sattunud, kuid tema lauludega olin väga kursis. Ta esitas seal nii oma uusi kui ka vanu laule. Tema kõige esimeseks ja tuntumaks singliks on "Move", mis saavutas rahvusvahelise kuulsuse ning väga paljud välismaa asutused tunnevad ta vastu suurt huvi. Matt Wills on 23-aastane Suurbritanniast Kentist pärit muusik ja laulukirjutaja. Temast polnud ma varem midagi kuulnud ning ta väga ei meeldinudki mulle. Ta esitas tuntud pop-laule kitarri saatel, mida ta ise mängis. Oma muusikalisteks eeskujudeks peab n...

Muusika → Muusika
3 allalaadimist
Etiquette in America
3
doc

Etiquette in America

1. TELEPHONE ETIQUETTE · When answering the phone at your desk say..."Hello, this is Mr. or Ms. Smith". Do not say phrases such as... "Smith here!" or simply "Hello". · Many people think it is rude when you use call waiting to talk to someone else in the middle of the conversation you are having with them. · When using a cell phone, try to find a quiet spot to answer a call. It is considered particularly rude to leave a cell phone turned on in public places like: classrooms, libraries, movie theaters, churches, etc. 2. CLOTHES AND DRESS · Also, pay attention to how much of your body you are exposing (have uncovered) and whether it is appropriate for the situation. (Ex. shorts, sandals, a very short or very tight skirt, or low cut or too tight shirt, are really not appropriate for meetings, interviews, etc.) Wearing this type of clothing can also communicate the same negativ...

Keeled → Inglise keel
3 allalaadimist
Dear Ms
1
docx

Dear Ms

Dear Ms. Smith My name is John Walker, I am a secretary of Science Club in our college. I have seen your advertisement about our local museum and I was wondering if I could ask you some questions about organising a group visit to it. I think that it will be a very interesting and informative event for students, after all, you don't get to see such an exhibition like "the next 100 years" every day. Therefore, if you are interested in our visit, I have some questions about the booking. Where can we make a reservation for our group? Do we need to come to the museum to do it or is it possible to do the booking through your website? How big can the visiting group be? We have 27 students who are interested in visiting the museum; is that too many or just fine? Since we will probably be coming for the whole day, we need to feed all the students. Do you have a café nearby or do we need to take the food ourselves? I loo...

Keeled → Inglise keel
1 allalaadimist
Semi formal complaint letter
1
docx

Semi formal complaint letter

Dear Mr Smith, I am writing in because of a problem I have with the new neighbour, David, who has moved in downstairs. Unfortunately, his habits seems to be different than mine. The issue is that David is a musician who plays his electric guitar very late night. I understand he is in a band and needs to practice but I think he can not do this in apartment. I work in home, so for me, it is important to have silence so I can concentrate on my work. But when David is playing all the time it is unable to get any of my works done, except when he is out. Sometimes I have been forced to leave the apartment and work at the library because of the guitar playing was disturbing. I would appreciate it if you could speak to David and ask him to turn down the volume on his guitar or else to use headphones. I have spoken to him about it, but he has not listen to me. I will let you know as soon as the situation gets better. Tha...

Keeled → Inglise keel
19 allalaadimist
Inglise keele jaotusmaterjal
37
doc

Inglise keele jaotusmaterjal

MODULE 1 Greeting. Introducing oneself and the others. The alphabet. Spelling. The tenses. How to introduce yourself and others Formal introductions How to respond and reply to an May I introduce myself? I am John introduction Smith. How do you do. Allow me to introduce John Smith to Pleased to meet you. you. Standard introduction Nice to meet you. I'd like you to meet John Smith. Hello. I want you to meet John Smith. I'm so pleased to meet you. This is Jane Smith. I'm Jane Smith. My name's John Smith. Informal introduction Hi. John. Jane. Hello. Titles: Mr Mrs Miss Ms Ms is a modern form of address for women. It replaces the traditional forms of Mrs and Miss. Greetings Good morning/afternoon/evening...

Keeled → Inglise keel
42 allalaadimist
Red Hot Chili Peppers
26
pptx

Red Hot Chili Peppers

Red Hot Chili Peppers Jan Kristian Mõtsnik Nyo Gymnasium 11c 2015  Introduction  Red Hot Chili Peppers are an American funk rock band formed in Los Angeles in 1983.  Their musical style is funk, rock and punk rock.  They are still active today Original founders  Anthony Kiedis (active)  Michael „Flea“ Balzary (active)  Hillel Slovak (Died in 1988)  Jack Irons (Quit after Hillel’s death) Current members  Anthony Kiedis – lead vocals (1983–present)  Josh Klinghoffer – guitar, keyboards, backing vocals (2009–present, touring member 2007)  Michael "Flea" Balzary – bass, piano, trumpet, backing vocals (1983–present)  Chad Smith – drums (1988–present) Studio albums  The Red Hot Chili Peppers (1984)  Freaky Styley (1985)  The Uplift Mofo Party Plan (1987)  Mother's Milk (1989)  Blood Sugar Sex Magik (1991)  One Hot Minute (1995)  Californicatio...

Keeled → Inglise keel
1 allalaadimist
Red Hot Chili Peppers
13
pptx

Red Hot Chili Peppers

Red Hot Chili Peppers Jan Kristian Mõtsnik Nyo Gymnasium 11c 2015 Introduction Red Hot Chili Peppers are an American funk rock band formed in Los Angeles in 1983. Their musical style is funk, rock and punk rock. They are still active today Original founders Anthony Kiedis (active) Michael ,,Flea" Balzary (active) Hillel Slovak (Died in 1988) Jack Irons (Quit after Hillel's death) Current members Anthony Kiedis ­ lead vocals (1983­present) Josh Klinghoffer ­ guitar, keyboards, backing vocals (2009­present, touring member 2007) Michael "Flea" Balzary ­ bass, piano, trumpet, backing vocals (1983­present) Chad Smith ­ drums (1988­present) Studio albums The Red Hot Chili Peppers (1984) Freaky Styley (1985) The Uplift Mofo Party Plan (1987) Mother's Milk (1989) Blood Sugar Sex Magik (1991) One Hot Minute (1995) Californication (1999) By the Wa...

Keeled → Inglise keel
1 allalaadimist
Kirja kirjutamine inglise keeles
3
pdf

Kirja kirjutamine inglise keeles

Dear Sir/Madam (,) ----- Yours faithfully (,) (no name) Dear Ms/Mr Smith (,) ---- Yours sincerely (,) (w/ name) Layout My address Name Receiver’s name Address Salutation ( Dear Sir/Madam, Dear Mr/Ms/Mrs/Miss) Introduction: WHY I am writing Main body of the letter: WHAT I want to say ONE thing at a time; explain Conclusion: Solution, polite closure, reference for future meeting etc. Sign off (Yours faithfully, yours sincerely) Name Letter of Complaint 1. Salutation 2. Reasons for writing I am writing to complain about a kettle … 3. Complaint with justification / explanation I was disappointed with the quality of the kettle that I bought at your store two days ago. I was appalled at the inferior ...

Keeled → Inglise keel
9 allalaadimist
Mid-Atlantic States presentation in English
26
pdf

Mid-Atlantic States presentation in English

Mid-Atlantic states New York, Pennsylvania, New Jersey Virve Kass General  East coast of the Atlantic Ocean  From -25°C to 30°C  Tornadoes  270 294 km2  Population:  about 40.8 million History  1524 - Giovanni da Verrazzano  European colonists  Religious minorities  American Revolution  1776- Declaration of Independence  19th century- abolishing slavery  Industrial Revolution New York • Capital: Albany • Largest city: New York City • Population: 19,541,453 (2009) • Area: 128 403 km2 Statue of Liberty (1886) Twin towers- 9/11 attacks Liberty Bell Times Square Lucy The Margate Elephant Famous people • Jennifer Aniston • Eddie Murphy • Robert de Niro • Woody Allen • Oliver Stone • Lenny Kravitz • Christina A...

Keeled → Inglise keel
2 allalaadimist
Ajavormide teooria
18
doc

Ajavormide teooria

Windows are not made of wood. Simple Present · · New York is a small city. It is not important that this fact is untrue. [VERB] + s/es in third person USE 3 Scheduled Events in the Near Examples: Future · You speak English. · Do you speak English? · You do not speak English. USE 1 Repeated Actions Examples: · The train leaves tonight at 6 PM. · The bus does not arrive at 11 AM, it arrives at 11 PM. ...

Keeled → Inglise keel
47 allalaadimist
Black Beauty
4
docx

Black Beauty

Chapters 1–5: Black Beauty spent his young life with his mother on Farmer Grey’s farm. Farmer Grey was a good, kind man and the horses had a good life. His mother told him that not all people were good and she gave him some advice: ‘Always be good so people will love you. Always work hard and do your best’. Black Beauty tried to follow this advice all his life. First, he went to live at Birtwick Park with Mr Gordon and his family, who treated their horses well. He became friends with two other horses, Merrylegs and Ginger. He was cared for by a groom called John Manly, who never used a whip. His wife gave him the name of Black Beauty. He learnt to carry a rider and pull a carriage. Chapters 6 – 8: The stable boy, James, got a better job with a nearby farmer so he was trained by the head groom. One day, when he drove the carriage led by Black Beauty, they nearly had an accident. Thanks to the clever horse, they avoided a broken bridge an...

Keeled → Inglise keel
2 allalaadimist
What is integrated care
23
pdf

What is integrated care?

An overview of integrated care in the NHS What is integrated care? Research report Sara Shaw, Rebecca Rosen and Benedict Rumbold June 2011 Nuffield Trust work on integrated care This report is part of the Nuffield Trust's extensive programme of work on integrated care, which is examining the potential of new forms of care that are intended to benefit patients and taxpayers. Other related projects include: ·Integration in action: four international case studies. A study of four international organisations that have attempted to improve integration between health and care services. Interviews, documentary analysis and literature review are used to identify the main stimuli for integration and the issues that help or hinder progress; drawing out lessons for the NHS. ·Towards integrated care in Trafford. A project that looks at the process of change and lessons learned to date in Trafford, where NHS organisations have been worki...

Sotsioloogia → Sotsiaaltöö korraldus
13 allalaadimist
Filmide tegemine
19
pptx

Filmide tegemine

Filmitegemine Simona Andreas 9.c Filmivaatamine Filme vaadatakse erinevatel põhjustel. On kahte tüüpi inimesi. Filmitegemise 5 etappi -Arendamine -Eellavastus -Filmimine -Järellavastus ehk töötlus -Müük ja levik Arendamine Produtsent leiab projekti. Käib koostöö stsenaristiga Leitakse rahastaja. Projekt esitletakse rahastajatele Eellavastus Filmi tegemine on väga täpselt planeeritud projekt, pisidetailid panevad kokku just lavastus firmad (production company). Produtsendi tööks on palgata meeskond. Meeskond rezissöör - tegeleb filmimise endaga (kõik sellega seonduv) castingu Rezissöör- tegeleb castinguga, leiab näitlejad kes filmis osalevad asukoha juht- leiab filmimise asukoha ja tegeleb sellega stuudio vastutaja- tegeleb kogu finants osaga fotograafia rezissöör- tegeleb kogu fotograafiaga helirezissöör- tegeleb kogu ...

Muu → Amet
15 allalaadimist
School Bullying worksheet
2
doc

School Bullying worksheet

School Bullying Worksheet Respond to the questions below in detail. 1. What are the 4 levels of negative consequences of bullying specified by the text? General school climate, right of students to learn in a safe environment without fear, lifelong consequences. 2. What is the foremost source of formal bullying research? Scandinavian countries, Great Britain, and Japan. 3. Direct bullying behaviours include (5) teasing, taunting, threatening, hitting, stealing. 4. Indirect bullying is such as spreading rumours and enforcing social isolation. 5. Boys and girls differ in their bullying behaviours in that Boys typically engage in direct bullying methods. but girls are more apt to utilize more subtle indirect strategies. 6. In general terms, bullying can be defined as direct and indirect. 7. The amou...

Keeled → Inglise keel
2 allalaadimist
-Career and Employment-Homereading
8
doc

"Career and Employment" Homereading

Changing career: 'These days, I go home feeling relaxed' Starting a new career is a daunting prospect for many. But Kate Hilpern discovers that plenty of help is at hand Some of the jobs that career changers are most keen to break into ­ PR and teaching, among them ­ are the very same jobs that people are queuing to get out of, says John Lees, author of How to Get a Job You'll Love and Take Control of Your Career. Many of us get to the point, whether in our twenties, thirties, forties or fifties where we decide to change careers. Some of us will make radical changes, while others will move to the edge of their comfort zone, perhaps shifting from acupuncturist to homeopath or PR office to journalist. But the key to making the right decision, says Lees, is to bring your dream back down to life with a hard thump. "I always say to people, 'Find out what you will actually be doing in the job of your dreams. What does the nitty-gritty day-...

Keeled → Inglise keel
45 allalaadimist
Writing e-mails in English
1
doc

Writing e-mails in English

Writing letters Main rules !!!Always write something on the "Subject" line (university emails: e.g. name or code of the course, then issue, topic etc) If the matter is urgent, you may write so on the "Subject" line Start and end your email properly (also making sure the other person knows who you are) "you" ­ is spelled with a capital letter only at the beginning of a sentence, NEVER in the middle In official emails ­ do not abbreviate (e.g., "I am" instead of "I'm", "do not" instead of "don't", "cannot" instead of "can't" etc). Also, do not use colloquial expressions such as "fyi" etc. Pay attention to punctuation and spelling ­ use spell check. Specifics ­ beginning a letter If you don't know the name of the recipient: Dear Sir/Madam, To whom it may concern, If you know the name of the recipient: Dear Mr/Ms Jones, If you know the name and it's informal (or you have been writing emails to each other ...

Keeled → Inglise keel
7 allalaadimist
Referencing style-kuidas kirjandites autoritele viidata
6
doc

Referencing style, kuidas kirjandites autoritele viidata

REFERENCING STYLE The following recommendations have been taken from The Standing Committee on Publications of the British Psychological Society, Suggestions to Contributors, Leicester: BPS, 1979. You should always follow these recommendations in your written work. The BPS journals use the author-date method of citation, that is the surname of the author and the year of publication are inserted in the text at the appropriate point, for example: Rabbitt (1970) compared reaction times... Or In a recent study of reaction times, Rabbitt (1970) found... Or In 1970, Rabbitt compared.. These methods enable the reader to locate easily the citation in the reference list given at the end of the report. If a work has two authors, cite both names in the text every time, e.g. Smith & Jones (1974). If a work has three or more authors, give names in full...

Psühholoogia → Psühholoogia
1010 allalaadimist
Atlantise allkaik
1
txt

Atlantise allkaik

Jumalik Inimene kaotab oma valguse kui ta laskub alla Suure Aasta tsklit mooda, uinub ja unustab levuse endas ... "Palju plvkondi , kuni jumalik loomus veel kestis neis , olid nad seadusele kuulelikud ja Jumala suunas sdamlikud, mille seeme nad olid , sest nad omasid telist ja igal viisil suurt hinge .. " Kuid Atlantislased said rikutud: " ... kui Jumaliku osa neis hakkas hbuma , ning lahjenes liiga palju surelikkuse segunemisest ja inimloomus vttis vimust, nad siis ei suutmata kanda oma varandust, kitusid ebasndsalt ning sellele, kel oli silm ngemaks, muutus nhtavalt rikutumaks, "- Platon, " Critias " , 360BC We see the coming change of the cycles left to us to be discovered in Mythologies, in Arts, in Hermetics, in Folk even in Fairytales where young girl (Divine Female) needs to be saved... They all speak about times, when th Humanity falls asleep and becomes materialistic, forgets where it originates... this is the time ...

Filosoofia → Filosoofia
6 allalaadimist
Digital Signal Processing Vocabulary
3
docx

Digital Signal Processing Vocabulary

Digital Signal Processing Summary and Vocabulary Guide to Digital Signal Processing by Steven W. Smith. Read up to page 10, preface included. https://users.dimi.uniud.it/~antonio.dangelo/MMS/materials/Guide_to_Digital_ Signal_Process.pdf Digital Signal Processing (DSP) is a powerful technology that will shape science in the twenty-first century. Changes have already been made in various fields of study: communications, medical imaging, and high fidelity music reproduction, to name just a few. Each of these disciplines has developed a deep DSP technology, with its own algorithms and specialized techniques. This combination of breadth and depth makes it impossible for any one individual to master all of the DSP technology that has been developed. Therefore, DSP education involves two tasks: learning general concepts that apply to the field as a whole, and learning specialized techniques for your particular area of interest. The first ch...

Informaatika → Digisignaalide töötlemine
5 allalaadimist
Mormon Polygamy
1
rtf

Mormon Polygamy

Mormon Polygamy Polygamy was a defining characteristic of early Mormonism. Polygamy comes from Late Greek meaning ''often married'', is a form of marriage when a person has more than one spouse at the time. There are different types of polygamous families. When a man has more than one wife it is called polygny, when a woman has more than one husband it is called polyandry. If there are multiple wives and husbands it can be called group marriage. Mormonism is to say that it was dedicated to restoring everything in the Bible. Joseph Smith,Jr., Mormonism's founding prophet,who felt especially close to the Old Testament, believed his mission was to restore the customs from the Old Testament including the ancient Semitic custom of plural marriage. He himself did not acknowledge having multiple wives publicly since it was illegal. After Joseph Smith's murder by a mob on June 27, 1844, th...

Keeled → Inglise keel
3 allalaadimist
Guidelines for writing tasks
4
doc

Guidelines for writing tasks

Writing tasks Formal letters 120 words I Tegemist on ametliku kirjastiiliga ja lühivormid (don't, can't, I'm etc.)on keelatud! Kaotate kohe punkte II * Dear Mr. Smith (ja eesnime ei tohi kirjutada!!!) * Kui teame nime, siis lõpp Yours sincerely ja allkiri ja ülesandes antud nimi * Kui nime pole öeldud, siis Dear Sir or Madam * Kui nime ei tea, siis lõpus Yours faithfully ja allkiri ja ülesandes antud nimi Enda nime ei tohi mitte mingil juhul kirjutada!!!!! Te olete kas Jürid või Marid, Urved või Urmased jne. Kirjade tüübid: 1) Kui peate kirjutama kirja , kus tuleb kelleltki nõu küsida, siis alustage: I am writing to ask if you could help me with... I am writing to ask for your advice... Ja lõpetage I would appreciate if you could give me your advice as soon as possible või I look forward to receiving your advice... 2) Kui peate kirjutama kirja , kus tuleb ise nõustada, siis alustage: I am writing in reply to your letter asking a...

Keeled → Inglise keel
231 allalaadimist
Enrique Iglesias
14
ppt

Enrique Iglesias

B.R 10klass Täisnimi: Enrique Miguel Iglesias Preysler Popmuusik ja laulukirjutaja Sündis 8. mai 1975 Madriidis (35. aastane) Tal on ilmunud 9 stuudioalbumit Isa Julio Iglesias ­ kes samuti kuulus laulja Ema Isabel Preysler ­ kes oli ajakirjanik Tal on 3 poolvenda ja 3 poolõde Kõige noorem poeg 1978 vanemad lahutasid ja 1983 läks ta isa juurde Miamisse elama Isal oli palju tööd ja seega kasvatas teda rohkem lapsehoidja Külastas ema igalsuvel Noorena teadis, et vanemad ei toeta teda muusikakarjääril siis laenas ta 500$ oma lapsehodjalt, et salvestada demo Ta kartis, et teda hinnatakse kuulsa perekonnanime pärast Alguses esines kui Enrique Martínez Alustas muusikakarjääri Mehhiko plaadifirmas Fonovisa ( 3'e aastane leping) Langes välja kolledzist ja läks Torontosse, et oma esimene album salvestada 12 juuli 1995 ilmus esimene album nimega Enrique Ig...

Muusika → Muusika
8 allalaadimist
Jane Austeni-Emma-ja-Persuasion
2
rtf

Jane Austeni "Emma" ja "Persuasion"

EMMA Youthful Emma Woodhouse, whose long-time governess and friend Miss Taylor has just married Mr. Weston, takes some solace in being left alone with her aging father by claiming that she made the match herself. An old friend of the family, Mr. George Knightley, does not believe her, but in her certainty she decides that she must also marry off the young rector, Mr. Elton. Among her friends and acquaintances in the large and populous village of Highbury, she begins to notice young Harriet Smith, the pretty illegitimate seventeen-year-old who lives at Mrs. Goddard's boarding school. Determining first to improve Harriet, Emma discourages her interest in worthy Robert Martin of Abbey-Mill Farm, declares that Harriet must be from more genteel parents than his, and fixes upon Harriet as Mr. Elton's future wife. In bringing the two together socially, Emma does a drawing of Harriet which Mr. Elton admires and takes off to London to be frame...

Kirjandus → Inglise kirjandus
29 allalaadimist
Unit 5 p 102-105
5
doc

Unit 5 p.102-105

ADVANCES IN TECHNOLOGY 1. My new cellular phone allows me to send text messages anywhere within the country and abroad. (communications) 2. Don't forget to turn on the modem if you want to go-online. (information technology) 3. The advent of endoscopic surgery has greatly reduced the post-operative recovery time of most patiens. (medical) 4. Supermarkets of the future will make use of scanners to read the contents of your trolley and total up your bill. (electronics) 5. Factories which rely on humans working on assembly lines are becoming a thing of the past. (industrial) 6. You would be quite astounded by the number of satellites orbiting the Earth. (space) 7. Not only would a solar powered vehicle be safe, it would also make use of one of the planet's greatest natural resources. (energy) COMPUTERS 1. I'm terribly sorry I'm late but traffic congestion...

Keeled → Inglise keel
6 allalaadimist
Prepositions
16
pdf

Prepositions

Prepositions Table of Contents Prepositions of Time – in, on & at ....................................................................... 2 Prepositions of Time – for & since ....................................................................... 3 Prepositions of Time – for & during ..................................................................... 3 Prepositions of Time – during & while ................................................................. 4 Prepositions of Time – by & by the time .............................................................. 4 Prepositions of Time – until & from ... till / to ... ................................................. 4 Prepositions of Time - ago................................................................................... 5 Prepositions of Place – in ..........................................

Keeled → Akadeemiline inglise keel
26 allalaadimist
Esitlus Iron Maiden ist
18
pptx

Esitlus Iron Maiden'ist

Click to edit Master text styles Second level Third level Fourth level Fifth level Iron Maiden § English heavy metal band from Leyton in east London, formed in 1975 by Steve Harris & Dave Murrey § Named after a torture device. § 15 studio albums. § 11 live albums. § 4 extended plays. § 7 compilations. § Iron Maiden have sold over 85 million records worldwide § Over 2000 live peformances. § Their music has influenced dozens of famous bands, most notably Metallica and the Red Hot Chili Peppers § Most famous lead vocals: Paul Di'anno , Bruce Dickinson; Blaze Bayley. § They have been active since 1975 ­ present . Click to edit Master text styles Second level Third level Fourth level ...

Biograafia → Kuulsused
2 allalaadimist
Inglise keele riigieksami kirjutamise spikker- suur kokkuvõte
8
doc

Inglise keele riigieksami kirjutamise spikker / suur kokkuvõte

Riigieksami teiseks ülesandeks on kas essee või aruandekirjutamine; nõutud pikkuseks on 200 (+/- 10%) sõna. Esseed ja aruannet hinnatakse neljast kriteeriumist lähtuvalt: ülesandetäitmise täpsus, teksti korrasta tus, sõnavara ja grammatika. Essee (Essay) teemad on õppekava teemade põhjal sõnastatudarvamused või väited, mis puudutavad kaasaegset maailma janõuavad seisukohavõtmist antud küsimuses. Essee pi kkus onneli kuni viis lõiku. Esimene lõik moodustab sissejuhatuse, kusesimene lause peak s tõmbama lugeja tähelepanu (hook) ningpaar järgmist lauset peaksid viima sealt essee p õhiväiteni (thesis statement). Kaks kuni kolm lõiku peaksid nüüd põhiväidetavama. Igas lõigus esitatakse esi meses lauses väide (topic sentence) ja tõestatakse/toetatakse seda siis näidete, arvude võitsitaadiga (supporting evidence). Oluline on, et igas lõigusräägitakse ainult ühel teemal, ega hüpata ühelt argum endiltteisele. Viimane lõik moodustab kokkuvõtte ...

Keeled → Inglise keel
175 allalaadimist
Proseminar
8
doc

Proseminar

FGI 1811 Proseminar (Irina Ladusseva) 2.0 AP Kab. 420 03.09.2002. Writing a term paper (this spring) and graduation paper. To get a pass: one written task (part of introduction, thesis statement) Term paper should be printed (20-25 pages long). Graduation paper should be printed (50-60 pages long). First write term paper, and choose a topic right now (theme of term paper later will be developed into graduation paper). Rights: we have a right to have a supervisor. Supervisor writes on the front page "Lubatud kaitsmisele". You need time to: 1. read the theory 2. collect material 3. regularity (1-2 hours a day deal with your paper) The first draft of term paper should be ready by March. Supervisors are: 1. Suliko Liiv (country study, grammar, contrastive studies, methodology) 2. Liliana Skopinskaja (methodology) 3. Jaanika Marley (foneetika, methods) 4. Ene Alas (translation, meth...

Õigus → Proseminar
36 allalaadimist
The article
20
pdf

The article

The Article Table of Contents General Rules....................................................................... 2 The Definite Article ............................................................... 5 Names that take the Definite Article...................................... 6 No article.............................................................................. 7 Countable and uncountable nouns ....................................... 9 General Rules There are two articles in the English language – the Indefinite Article and the Definite Article. The Indefinite Article has two forms – a and an (a precedes words beginning with a consonant sound and an precedes words beginning with a vowel sound). It comes from the Old English word ãn, which meant one. The Definite Article is the. It comes from the Old English word ţis, which meant this. Thus, in most general term...

Keeled → Akadeemiline inglise keel
17 allalaadimist
Entertainment and Art
6
docx

Entertainment and Art

Entertainment and Art Task 1. Underline the most suitable word or phrase. a) I like this book, and I've read six capitals/chapters/prefaces already. b) It's not a proper drawing, only a rough/plan/sketch. c) The play is very long but there are three breaks/intervals/rests. d) At the cinema I don't like sitting too near the film/screen/stage. e) We heard a piece by Mozart performed by a German band/group/orchestra. f) Her second book was very popular and became a best buy/seller/volume. g) I like the painting but I can't stand its ugly border/frame/square. h) Robert's new book will be broadcast/published/typed in August. i) I liked the acting, and the costumes/dressing/outfits were good too. j) The best act/place/scene in the film is when Jack meets Kate. Task 2. Complete each sentence with a word from the box. Use each word once only. Announcer composre critic editor playwrigh...

Keeled → Inglise keel
2 allalaadimist
Letters
38
doc

Letters

Letters Letters FORMAL, INFORMAL, TRANSACTIONAL TASK 1 Read the extracts and answer the questions. · Where are the extracts from? · What is the purpose of each letter? · How do they differ? · Which extracts are examples of formal letters? · How is the reader addressed in a formal letter? · What are the closing remarks for formal letters? · What is the salutation in a friendly letter? · How would you end extracts 1,2,3 ? · How would you begin the extracts 4 and 5? 1. Dear Mr Miller, I received your kind invitation to the reception. Unfortunately, owing to other commitments. I will be unable to attend ... 2. Dear Ralph, l just got your invitation to the company's event. l `m afraid I can't make it because I've a/ready made plans which l can "t change ... 3. Dear Sirs, I am writing to complain about the poor quality of ...

Keeled → Inglise keel
32 allalaadimist
Maailmausundite statistika 3 - prognoos
26
pdf

Maailmausundite statistika 3 - prognoos

http://www.pewforum.org/2015/04/02/religious-projections-2010-2050/ APRIL 2, 2015 The Future of World Religions: Population Growth Projections, 2010-2050 Why Muslims Are Rising Fastest and the Unaffiliated Are Shrinking as a Share of the World’s Population The religious profile of the world is rapidly changing, driven primarily by differences in fertility rates and the size of youth populations among the world’s major religions, as well as by people switching faiths. Over the next four decades, Christians will remain the largest religious group, but Islam will grow faster than any other major religion. If current trends continue, by 2050 …  The number of Muslims will nearly equal the number of Christians around the world.  Atheists, agnostics and other people who do not affiliate with any religion – though increasing in countries such as the United States and Fra...

Teoloogia → Usundiõpetus
1 allalaadimist
Nelson Mandela
11
doc

Nelson Mandela

Nelson Rolihlahla Madiba Mandela Sisukord 3 ­ Päritolu 4-5 ­ Haridus (1925-1942) 6 - Poliitika (1942-1952) 7 ­ Poliitika (1953-1964) 8 - Vanglas 9 ­ Hr. President 10 ­ Lisa 11 ­ Kasutatud kirjandus Päritolu Mandela sündis Lõuna-Aafrikas. Rahvuselt on ta koosa, Thembu hõimu liige. Koosad kuuluvad bantu keeli rääkivate rahvaste hulka. Varem asustasid nad suurema osa Lõuna-Aafrikast. Pärast eurooplaste saabumist suruti nad aga Transkei ja Ciskei piirkonda (kagusse). Koosad on jagunenud väiksematesse alarühmadesse, üks neist hõimudest on Thembud. Ngubengcuka, Mandela vanavanaisa oli selle hõimu 1832. aastal ühendanud. Hiljem sai Mandela vanaisast Thembude kuningas. Mandela isast Gadla Henry ...

Ajalugu → Ajalugu
38 allalaadimist
The Moon Is Down
2
odt

The Moon Is Down

The moon is down Author: John Steinbeck.(February 27, 1902--December 20, 1968) John Steinbeck III was one of the best-known and most widely read American writers of the 20th century. He wrote the Pulitzer Prize-winning novel The Grapes of Wrath, published in 1939 and the novella Of Mice and Men, published in 1937. In all, he wrote twenty-five books, including sixteen novels, six non-fiction books and several collections of short stories. In 1962 Steinbeck received the Nobel Prize for Literature. In his subsequent novels, Steinbeck found a more authentic voice by drawing upon direct memories of his life in California. Later he used real historical conditions and events in the first half of 20th century America, which he had experienced first-hand as a reporter. Steinbeck often populated his stories with struggling characters; his works examined the lives of the working class and migrant worker...

Keeled → Inglise keel
17 allalaadimist
Organisatsiooni ja juhtimise teooriad
4
docx

Organisatsiooni ja juhtimise teooriad

Juhtimine TMO0010 2.loeng: Organisatsiooni ja juhtimise teooriad Mis on organisatsiooni- ja juhtimisteooria? - Teadmiste, seaduspärasuste, reeglite, mudelite ja ühiste terminite süsteem, millest juhtimisteadlased ja praktikud oma töös lähtuvad. Parimal juhul on teooria praktikas valideeritud. Teooria areng toimub kahte pidi: 1) ajugümnastikast ärisse 2) praktika uurimisest teooriaks Juhtimine on sama vana kui inimene: Platon-liidrist, Aristoteles-rääkimise jõust, Sparta- distsipliin ja efektiivsus, Vana-Rooma-süsteemsus ja tööjaotus, Machiavelli-riigi juhtimisest, Adam Smith- tööjaotus ja organisatsioonistruktuur Teooriate tüpoloogia: Klassikalised teooriad: - Teadusliku juhtimise koolkond - Taylor - Administratiivne koolkond - Fayol - Bürokraatlik koolkond - Weber Neoklassikalised teooriad: - Inimsuhete koolkond - Mayo - Inimressursi koolkond ­ Maslow ja McGregor Moodsa...

Majandus → Organisatsiooni ja juhtimise...
74 allalaadimist
Inglise lauljad ja ansamblid
9
docx

Inglise lauljad ja ansamblid

ABSTRACT FAMOUS SINGERS AND BANDS IN THE ENGLISH 2010 Contents: page The Bands · The Beatles 3 · The Who 4 · Placebo 5 · The Kooks 6 · Coldplay 7 The Singers · Sir Elton Hercules John 8 · Andrew Abraham 9 · Robert Peter "Robbie" Williams 10 · Christopher Anthony John "Chris" Martin 11 The Bands The Beatles were an English rock band, formed in Liverpool in 1960 and one of the most commercially successful and critically acclaimed acts in the history of popular music. From 1962 the group consisted of John Lennon (rhythm guitar, vocals), Paul McCartney (bass guitar, vocals), George Harrison (lead guitar, vocals) and Ringo Starr (drums, vocals). Rooted in skiffle and 1950s rock and roll, the group later worked in many genres ...

Keeled → Inglise keel
6 allalaadimist
Bob Marley
7
doc

Bob Marley

Bob Marley This article is about the reggae musician. For the comedian, see Bob Marley (comedian). Bob Marley Bob Marley in concert, Zürich, 1980. Background information Birth name Robert Nesta Marley Also known as Tuff Gong February 6, 1945 Born Nine Mile, Saint Ann Parish, Jamaica May 11, 1981 (aged 36) Died Miami, Florida, United States Genre(s) Reggae, Reggae Rock, Ska, Rocksteady Occupation(s) Singer, songwriter, guitarist Instrument(s) Guitar, vocals, percussion Years active 1962 ­ 1981 Studio One, Beverley's, Upsetter/Trojan, Label(s) Island/Tuff Gong Associated The Wailers Band, The Wailers acts Website www.bobmarley.com Robert "Bob" Nesta Marley OM (February 6, 1945 ­ May 11, 1981) was a Jamaican singer, songwriter, guitarist, and activist. He is the...

Keeled → Inglise keel
9 allalaadimist
DIALOGUES inglisekeelsed dialoogid erinevatel teemadel
6
pdf

DIALOGUES inglisekeelsed dialoogid erinevatel teemadel

H-Helen, J - Julia 1.Receiving a money order H: - Hello, I would like to cash a money order. J: - Hello! You should present your identity card. H: - But, you know, I'd like to receive money order for my sister. How do I go about it? J: - Your identity card and letter of attorney, please. H: - Here you are. J: - Well...Unfortunately, I can't cash your money order ­ your signature is not witnessed. H: - Ok. Than, please, I'd like to cash my money order. J: - Take this form and fill it in. May I see your passport? H: - Yes. Please. So...Should I write my full name, my passport number and the sum of money that has been sent to me, right? J: - Certainly. How would you like the money? H: - I prefer one hundred rouble notes, if you don't mind. J: - Here is your money. H: - Thank you Getting a post-restante. H: - Hi, Julia! What are you doing here? J: - I'm getting post restante letter from Boris... H: -Ah, yeah, remember him. What is he...

Keeled → Inglise keel
18 allalaadimist
Järjestuste võrdlemine-otsingud andmebaasidest-BLAST-FASTA-SW-
23
doc

Järjestuste võrdlemine, otsingud andmebaasidest (BLAST, FASTA, SW).

Bioinformaatika ülesanded Järjestuste võrdlemine, otsingud andmebaasidest (BLAST, FASTA, SW). 1. BLAST programmide kasutamine tundmatu valgujärjestuse identifitseerimiseks või sarnaste valgujärjestuste leidmiseks (http://www.ncbi.nlm.nih.gov/BLAST/). Programmide kasutamisel tutvuda tutorialite ja juhenditega!!! (http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/information3.html). a. Otsida sarnaseid järjestusi antud valgujärjestusele. Valida sobiv programm vastavalt NCBI juhendile valgujärjestuse võrdlemiseks valgujärjestuste seast. Valida otsimiseks Refseq andmebaas, sooritada otsing, tulemuste formaat 500 joondamise jaoks. GTESPLLTDPSTPNFFWLAWQARDFMSKKYGQPVPDRAVSLAINSRTGRTQNHFHIHISCIRPDVRKQLDNNLAN ISSRWLPLPGGLRGHEYLARRVTESELVQRSPFMMLAEEVPEAREHMGRYGLAMVRQSDNSFVLLATQRNLLTLN RASAEEIQDHQCEILRMRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEM...

Informaatika → Bioinformaatika
41 allalaadimist


Sellel veebilehel kasutatakse küpsiseid. Kasutamist jätkates nõustute küpsiste ja veebilehe üldtingimustega Nõustun