VAADELDAV VALK: Forkhead box protein O3 Transkriptide võrdlus Homo Sapiens FoxO3 järjestusega Kattuvad Organism Järjestuse ID Pikkus järjestused Identsed alused Tühikud Pan troglodytes Simpans ref|XM_003311514.2| 7946 1 7076/7133(99%) 18/7133(0%) Sumatra Pongo abelii Orangutan ref|XM_002817219.2| 7812 1 7190/7343(98%) 46/7343(0%) Gorilla gorilla gorilla Gorilla ref|XM_004044495.1| 7595 1 7024/7175(98%) 73/7175(1%) Macaca mulatta Reesusmakaak ref|XM_001093593.2| 7300 1 7079/7328(97%) 66/7328(0%) Papio anubis Anubis baboon ref|XM_003898343.1| 7775 1 7094/7353(96%) 60/7353(0%) Dasypus 4216/4873(8...
GGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQAMKPGCTLFFLLCSALTVTTEAHAQTPDTA TTAPYLLAGAPTFDLSISQFREDFNSQNPSLPLNEFRAIDSSPDKANLTRAASKINENLYASTALERGTLKIKSI QMTWLPIQGPEQKAAKAKAQEYMAAVIRTLTPLMTKTQSQKKLQSLLTAGKNKRYYTETEGALRYVVADNGEKGL TFAVEPIKLALSESLEGLNKMTIQQWLFSFKGRIGRRDFWIWIGLWFAGMLVLFSLAGKNLLDIQTAAFCLVCLL WPTAAVTVKRLHDRGRSGAWAFLM VASTUS: Kasutasin programmi Protein-protein BLAST (blastp) Format alignments 500 Sarnased järjestused Database: NCBI Protein Reference Sequences Posted date: Apr 9, 2006 5:23 AM Number of letters in database: 811,773,583 Number of sequences in database: 2,250,671 Lambda K H 0.319 0.133 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2250671 Number of Hits to DB: 127332226 Number of extensions: 4937094 Number of successful extensions: 13884 Number of sequences better than 10: 117
Beekeepers are considered virile, because they regularly eat larvae from their beehives De-winged dragonflies boiled in coconut milk with ginger and garlic. The agave worm, is eaten on tortillas and placed in bottles of mezcal liquor. Casu marzu- riddled with live insect larve, also called a rotten cheese. In Europe and USA it´s not popular. Why it´s good? Protein, but also vitamins, minerals, and fats. Crickets are high in calcium, and termites are rich in iron. Hamburger-18% protein and 18% fat. Cooked grasshopper- 60% protein and 6% fat. 45 kgs of feed produces 4.5 kgs of beef but 20 kgs of cricket. Products which can contain insects Canned citrus frukt juices- Insects and insect eggs 5 or more and other fly eggs per 250 ml or 1 or more maggots per 250 ml Chocolate and chocolate liquor- Insect filth, 60 or more insect fragments per 100 grams Peanut butter Insect filth, 30 or more insect fragments per 100 grams Thank you for listening! http://www.youtube.com/watch
FOOD FOR SPORT Eating right can help energize your workout. What is the best thing to eat before exercising for energy and endurance? You need quality carbs, lean protein, heart-healthy fats, and fluids. Your muscles rely on carbohydrate foods like breads, cereals, pasta, rice, fruits, and vegetables for quick energy. You need protein for your muscles and for your blood cells, which bring nutrients and oxygen to your muscles. You also need fluids, or your body will have a hard time performing at its best. Is there an ideal meal to eat before exercise? There's no one meal that you need to eat before working out. Instead, focus on these 5 things: Low fat Moderate in carbs and protein Low fiber Includes fluids Made up of familiar foods that you tolerate well
Magistriõpe 2003 - 2006 Tartu Ülikool, Füüsika- keemiateaduskond, keemia eriala, Bakalaureuseõpe Teadusorganisatsiooniline 2006 - ... Eesti Biokeemia Seltsi liige ja -administratiivne tegevus Teaduskraadi info Darja Lavõgina, doktorikraad, 2010, (juh) Asko Uri, Development of protein kinase inhibitors based on adenosine analogue-oligoarginine conjugates, Tartu Ülikool, Loodus- ja tehnoloogiateaduskond, Tartu Ülikooli Keemia Instituut Darja Lavõgina, magistrikraad, 2007, (juh) Asko Uri, Protein Kinase-Bisubstrate
Fast food can wreak havoc on your health if you aren't careful. Limit stops at fast food restaurants, and when you do go, bypass the French fries and other fried treats. Order salads, sandwiches that don't contained fried or greasy meat, and baked potatoes. Select pizza healthy pizza toppings, such as olives, mushrooms and green peppers. If you must have meat, opt for Canadian bacon, which is much lower in fat than pepperoni. Even college students need a balanced diet of protein, vitamins, minerals, carbohydrates and fats. Eat a variety of vegetables and moderate amounts of protein. Limit fats to the healthier choices, such as olive oil and nuts. for decades, vending machines have been the bane of many college students. They also carry the responsibility for the unhealthy "freshman fifteen," referring to the number of pounds college students often put on their first year at college. If you keep healthy snacks, such as raw veggies, yogurt and
life. Comparing with the past, the variety of different nonanimal products available has increased considerably and is sufficient to provide a healthy diet. However, it can be said there are both advantages and disadvantages for deciding to be a vegetarian. Firstly, vegetarians feel that there are certain advantages to be gained by not eating meat. They consider substitute foods such as soya, cereals and vegetables to be an even better source of protein than meat. It is maintained that such foods are low in fat and cholesterol, therefore promoting better health. Finally, by avoiding meat, vegetarians believe they are not eating contaminated food which is often a source of many illnesses. On the other hand, some people feel that being a vegetarian also has disadvantages. For example, such a diet can be boring and tasteless. Moreover, the choice of food available is often limited when eating out
movement a major effort filled with stress and pain. When people are hungry that means their blood sugar dropped,they feel tired,irritable and depressed and starvation.They're becoming more agressive to things around them.Solution for that is eating regularly and choosing foods that release energy slowly will help to keep sugar levels steady. I think food affects our well-being,because is one of the important thing for our body. Food gives substances like vitamines,minerals,carbohydrates and protein to our body. When people starving,they feel weakness in their body,because their body don't get enough substances.Then immunity becomes weaker,if body don't get enough minerals then their bones becomes also weaker and are easly breakable.Food helps to raise people mood and I agree with it.It depends what people eat, if people eat food that consists few substances they still will be feeling starvation.People must eat that kind of meal that consists protein,carbohydrate and fat.If body gets
1. (a) (i) gene length of DNA; codes for a (specific), polypeptide / protein / RNA; max 1 allele alternative form of a gene; found at a, locus / particular position on, a chromosome; max 1 (ii) assume allele refers to coat colour allele (coat colour) gene / alleles, only on X chromosome; A no (coat colour), gene / allele, on Y chromosome male cats, XY / only have one X chromosome;
, . , , . . 34 1.4.7 13. , . , . , . [13] . . 13 , . 36 2. : , , . : : Optimum Nutrition (), Myprotein () Syntrax (). 2.1.1 1 1 Optimum Nutrition 100% Whey Gold Standard 0.04 Myprotein Protein Pancake Mix 0.08 Syntrax Nectar sweets 0.05 100 «Optimum Nutrition» 78.5 , 5.8 3.8 . . . 3. 100 «Myprotein» 69 , 12 6.4 . , . . 3. 100 «Syntrax» 82.1 , 0 0 . . . 3. : «Syntrax», 100 82 , «Myprotein», 100 69 . 38 2.2
For example it is reported that in potatoes that have higher strach content and closely packed cell arrangement, the fracturability is higher. Cooking or just thermal heating starch leads to an increase of hydrolysis and therefore makes it easier for enzymatic attack in the gastrointestinaal tract. Slide 6 Starch digestion is also different in various foods with diferent components. Proteins that attaches to starch granules may make harder to digest starch. Cooking starch with protein may also reduce effectness of digestion. Protein forms around starch and it is harder to break through to starch. Ohter study found out that adding sodium sulphite to starch can prevent enzyme-resistant polymers that increase the speed of digestion because amylotic enzymes can easily hydrolyse starch. Removing gluten may also work to increase digestion time, but adding it back doed not reverse the reaction. Slide 7 This study found out how important is starch in our everyday life
NDF, decreased CP, DDM, ME. Especially in the first cut the quality declines rapidly when the forage biomass increases. Dynamics of quality changes depended on the speed of species' seasonal development. Botanical composition of lucerne-grass mixtures showed positive correlation between percent of lucerne and CP (r = 0,73; p < 0,05) and negative correlation between percent of lucerne and NDF (r = -0,55; p < 0,01). The harvests of the lucernes had positive protein balance values (PBV) in the rumen. The PBV was decreased close to zero in the `Karlu`/`Molisto`, `Karlu´/`Darimo` and `Karlu`/`Lincoln` mixtures of the first cut. Hybrid lu- cerne ´Karlu´ was more persistent in the mixtures compared to common lucerne ´FSG 408 DP´. Keywords: crude protein (CP), dry matter digestibility (DDM), metabolizable energy (ME), neutral-detergent fiber (NDF) Uno Tamm, Paul Lättemäe, Silvi Tamm, Estonian Research Institute of Agriculture, 13 Teaduse St
Tallinna Tehnikaülikool Protokoll Valgu kontsentratsiooni määramine Bradfordi meetodil Tallinn 2012 Spektrofotomeetria põhialused. Valguse neeldumine keskkonnas on kirjeldatav järgmise skeemiga: , kus I0 - pealelangenud kiirguse intensiivsus; d - valgust neelava kihi paksus; I1 - paksusega d neelava kihi läbinud kiirguse intensiivsus. Valguse neeldumise mõõtmiseks kasutatakse kahte erinevat, kuid omavahel seotud parameetrit: 1. T - Läbilaskvus (transmittance) , mida väljendatakse protsentides. I T= I0 2. A - Absorbtsioon (absorbance), mis on seotud I ja I0ga ning T-ga järgmiselt: I0 A = log = - log T ...
porridge, sandwich and drink cup of tea. My eating habits are healty because i care what i eat. I am sportman and i have control what i consume. I eat every kind of foods: meat, fish, fruits and vegetables. My favorite food is rice wiht pineapple and chichen sauce. My favorite dessert is pancakes with chocolate cream. Healty eatings are if people eat normally about 3-4 times a day. People must eat every kind of food: meat, fish, fruits, vegetables and consume every kind of nutrients: protein, fat, carbohydrate and gluvose. Draw a conclusion from my eating habits and healty eating habits. People must consume every kind of foods and nutrients. Keith Stseglov 11.c
Behaviorism (behavior can be studied and explained) Humanism (the human dimension of psychology) Transpersonal psychology (hippie psychology) Hierarchy of human needs http://en.wikipedia.org/wiki/Maslow's_hierarchy_of_needs D-needs and B-needs Basic needs (D = deficit) physiological safety beloning esteem Higher need (B = being) self actualization What a man can be, he must be! Physiological needs Homeostasis oxygen water protein salt, sugar, calcium ... In Maoist China the most basic need was belonging Safety, love and esteem Stability, structure, order Community, affection Status, dignity, reputation Once the D-needs are satisfied they are no longer motivating. Beyond basic needs What a man can be, he must be! Self-actualization, being need Depends on the satisfication of D-needs Never fully satisfied Thank you! Questions?
In my family people drink alcohol only on birthdays or other celebratings like New Year. In my family all but grandfather smoke . I am the only one who does some kind of sport. In winter i often go swimming with my best friend , two times a week. In autumn and summer i go cycling or jogging. I like to keep me fit. Sad that other people in my family do not play sports at all. I like to eat the food that my granny makes for me. But i try not to eat much and unhealthy. Now i eat much vitamins and protein. A school child must eat about 2000-2500 calories at day , nut ii cant believe that we all eat so much. We all must look what we eat and how much we eat and we will be healthy. Your Sincerely Kristina
Terminid · SNARE, soluble N-ethylmaleimide sensitive factor adaptor protein; · Receptors TMD, Trans-membrane domain; · PR, Pathogenesis-related; · qRT-PCR, quantitative Real Time PCR; · CDD, Conserved Domain Database; · HMM, Hidden Markov Model; · MSA, Multiple sequence alignment; · PDB, Protein Data Bank; · DOPE, Discrete Optimized Protein Energy; · MOF, MODELLER Objective Function; · NILs, Near-isogenic lines · Leaf rust; · Ustilago maydis, maisinõe seen · bread wheat, Triticum suvitrühvel L · tobacco, Nicotiana tabacum · oder, Hordeum vulgare · riis O. riis indica · nr: mitte ülearune; · S-PI, susceptible patogeen nakatunud, · S-M, susceptible negative control; · GAPDH Glütseraaldehüüd-3-Fosfaat Dehüdrogenaas 3.5. SNARE geenide up-regulation leherooste nakkuse ajal nisus
For and Against Fast Food All people in the world need food, most popular is fast food and it is mace you feel good. Is it good or bad? Fast food is taste good, you will enjoy eating it. You can get it fast, “restaurants” are everywhere. Fast food is cheaper than a self-made food. Most popular and well-known fast food “restaurants” are “Mac Donalds” and Burger King. However are it is healthy? Most important that human body need protein, carbohydrates and fiber to stay alive. But it is not a enough, have to by also vitamins, minerals and lot of other substances . If you are hungry it is better to eat chunk, then by whit out food. Fast food dos not offer diverse and healthy food. Also there are contains a which is make addictive for it. Human can eat every kind of food, but you have to change it all the time, cant stuck on the same stuff. Some test saw, what happened them who eat chunk food every day, but my opinion is same
acid residues. Like other biological macromolecules, proteins are essential parts of organisms and participate in every process within cells. Many proteins are enzymes that catalyze biochemical reactions and are vital to metabolism. Most proteins are fold into unique 3- dimensional structures such as primary structure, secondary structure, tertiary structure and quaternary structure. The best-known role of proteins in the cell is as enzymes, which catalyze chemical reactions. Your body uses the protein you eat to make lots of specialized protein molecules that have specific jobs. For instance, your body uses protein to make haemoglobin, the part of red blood cells that carries oxygen to every part of your body. Other proteins are used to build cardiac muscle. Proteins have very important functions in our body. 17 Kasutatud materjal Grandberg, Igor. 1979. Orgaaniline Keemia. Tallinn: Kirastus Valgus Männik, A. 1985. Biokeemia
Dairy products are not only rich in proteins but also in unsaturated fatty acids. A glass of skimmed milk is ideal for breakfast or before going to bed. Children can consume cream enriched milk. They are rich in calcium, required for health of bones and teeth. Some of the most nutritious dairy foods are: · Milk · Eggs · Cholesterol free butter · Cottage cheese · Tofu Grains and Cereals A balanced diet must contain adequate proportions of protein. Cereals form an ideal source of carbohydrates. Pulses and grains are rich in fatty acids and proteins. Whole grains contain nutritious substances like iron, magnesium and phosphorous that act as cofactors for the enzymatic activities inside the body. The examples are: · Wheat bread · Brown rice · Oatmeal · Pasta · Soya bean · Cereal · Corns Other Products There are some other sources of proteins that play a vital role for body's metabolism
To be or not to be a vegeterian To be or not to be a vegeterian, that is the question. there are many positive and negative sides of being a vegeterian but what are they? First of all, many people think that being vegeterian is helthy but is it? Eating always plants does not give us protein that is wery important to our health. Secondly, vegetables does not give us fat, what is very important to keep warm and without it our kidneys run around in our body, and it is painful. It is clear, that for life we need many more nutritions, what we can get from green food. On the other hand it is healthy to be a vegeretian. People, who does not eat meat are fit and this is healthy. Our heart can work well and vegeterians dont need to worry about
Aminohapete süntees ja vajadused erinevatel loomaliikidel Richard Riispere Eesti Maaülikool 5.12.2014 Sissejuhatus • Aminohapped -> Valgud 22 Standardset aminohapet http://en.wikipedia.org/wiki/Protein#Nutrition • Loomad ei suuda ise sünteesida kõike 22-te aminohapet. • Aga nt. proliini suudab organism ise sünteesida, pole vaja omandada. (Osborne,T.B, Mendel,L.B, 1914:326) http://glossary.periodni.com/images/proline.jp • Vajalikke aminohappeid ei suuda loom ise sünteesida. Nt. aspartokinaas • Liikide erinevus ei seisne ainult füsioloogilistes erinevusest, vaid ka vanusest. http://www.allaboutwildlife.com/wp- content/uploads/2011/05/pandashyjk 20001.jpg • Young V.R., Pellett P.L., McLarney M.J. ...
resistance can spread by means of transposons. Also called jumping gene. · Trasktriptsiooni faktori sidumissait - Sidumissait on ala DNA-l, millele transkriptsioonifaktor seondub. Regioon (valgus, DNA-s jne), mis on spetsiifiliseks seostumiseks teistele molekulidele, ioonidele. · Speiser - geenide vaheline ala. Puuduvad prokarüootsetes geenides. · TBP - The TATA-binding protein (TBP) is a general transcription factor that binds specifically to a DNA sequence called the TATA box. Kuulub TFIID kompleksi. TBP is a subunit of the eukaryotic transcription factor TFIID. TFIID is the first protein to bind to DNA during the formation of the pre-initiation transcription complex of RNA polymerase II. TBP is also a necessary component of RNA polymerase I and RNA
EFFERENT – Carrying information away from a particular group of neurones ENDOCRINE GLAND – An organ which produces and secretes a hormone* directly to the bloodstream. ENDORPHINS - A group of neuropeptide transmitters which are produced in the CNS and bind to opioid receptors; they regulate the perception of pain ENKEPHALINS – A group of neuropeptide transmitters which are produced in the CNS and bind to opioid receptors; they regulate the perception of pain. ENZYME – A protein which has the ability to control a chemical reaction within a cell. EPINEPHRINE (SEE ADRENALINE) ESTROGENS – A group of sex hormones* more abundant in females than males. The brain contains numerous oestrogen receptors which is consistent with a hypothesis that estrogens play a neuroprotective role. EXCITATION – An influence of one neurone on another which facilitates an action potential. EXCITATORY POSTSYNAPTIC POTENTIAL (EPSP) – A change in local potential
Bees are flying insects closely related to wasps and ants. There are nearly 20,000 known species of bee, in nine recognized families, though many are undescribed and the actual number is probably higher. They are found on every continent except Antarctica, in every habitat on the planet that contains insect-pollinated flowering plants. Bees are adapted for feeding on nectar and pollen, the former primarily as an energy source, and the latter primarily for protein and other nutrients. Most pollen is used as food for larvae. Bees have a long proboscis (a complex "tongue") that enables them to obtain the nectar from flowers. They have antennae almost universally made up of 13 segments in males and 12 in females, as is typical for the superfamily. Bees all have two pairs of wings, the hind pair being the smaller of the two; in a very few species, one sex or caste has relatively short wings that make flight difficult or impossible, but none is wingless.
many of the world's best athletes and scientists. This puts me in a rather unusual position. I'm able to pull from disciplines and subcultures that rarely touch one another, and I'm able to test hypotheses using the kind of self-experimentation mainstream practitioners can't condone (though their help behind the scenes is critical). By challenging basic assumptions, it's possible to stumble upon simple and unusual solutions to long-standing problems. Overfat? Try timed protein and pre-meal lemon juice. Undermuscled? Try ginger and sauerkraut. Can't sleep? Try upping your saturated fat or using cold exposure. This book includes the ndings of more than 100 PhDs, NASA scientists, medical doctors, Olympic athletes, professional sports trainers (from the NFL to MLB), world-record holders, Super Bowl rehabilitation specialists, and even former Eastern Bloc coaches. You'll meet some
TUBERKULOOS Bioanalüütiku õppekava üliõpilane Diana Didenko Tuberkuloos on väga laialt levinud ohtlik nakkushaigus, mis võib kulgeda nii ägedalt kui ka krooniliselt Tuberkuloosi tekitajaks inimesel on bakter Mycobacterium tuberculosis Nakkusallikaks on eeskätt hingamiselundite lahtist tuberkuloosi põdev haige, kes levitab haigustekitajaid põhiliselt rögapiiskadega Maailma Terviseorganisatsiooni (WHO) andmetel haigestub tuberkuloosi maailmas igal aastal hinnanguliselt kaheksa miljonit ning sureb kaks miljonit inimest TUBERKULOOSI KLIINILISED SÜMPTOMID Palavik Öine higistamine Köha Hemoptüüs (verine köha) Kehakaalu langus Väsimus Rindkere valud Tuberkuloosi haigustunnused võivad sarnaneda paljude teiste tervisehäiretega ning tuberkuloos võib kulgeda mõnikord ka asümtomaatiliselt. UURINGUMATERJAL Mükobakterite suhtes on võimalik uurida kõiki kehavedelikke, eritisi ning...
Other popular drinks are kali and liquor Vana Tallinn. Many newspapers say young Estonian people have bad eating habits. The breakfast should be relatively rich in carbohydrates (k.bha.drets) , body waits in the morning to get carbohydrates (k.bha.drets) and the constant influx of nutrients is necessary. Lunch at the school canteen is served balanced food. Even buns are better than nothing. A bun consists of nutrients, mostly carbohydrates(k.bha.drets), less protein and fat. Dinner is the last meal time. It should consist of fruit and vegetables and be poor with carbohnydrates (k.b ha.drets). It is not unhealthy when you eat at 7 p.m., if you are active at least till 9 p.m.
Can't be replenished Most of our energy. May cause global warming. Wind energy is the fastest growing. Most renewable energy comes from the sun. Hydroelectric energy is the oldest and largest source. Renewable energy a.k.a "green" energy. Thank you for listening! We use energy every day. It surrounds us in different forms, such as light, heat, and electricity. Our bodies use the energy stored in molecules of substances like carbohydrates and protein to move, breathe, grow, and think. We also use energy to do work and to play. Humans have invented thousands of machines and appliances that use energy to make our work easier, to heat our homes, and to get ourselves from place to place. Some of these machines use electricity, while others, like automobiles, use the energy stored in substances such as gasoline. Renewable energy is energy generated from natural resources such as sunlight, wind, rain, tides, and
Piim, selle tekkimise keemiline protsess, biokeemiline koostis, erinevas vanuses ja erinevatel imetajatel Katarina Vainult Piima biokeemiline koostis Vesi Valgud (1-24%) Varustavad aminohappetega Kaseiin Ca, P Mitsellides, piimas suspensioonina Vadakuvalgud Valgud, mis jäävad peale kaseiini eemaldamist Allikas: Lipiidid (2-50+%) https://et.wikipedia.org/wiki/Vadak Energiaallikas, rasvhapped, rasvlahustuvad vitamiinid Triglütseriid ehk “rasv” Allikas: http://www.khuisf.ac.ir/prof/images/Uploaded_files/DairyChemistryAndBiochemistry_muyac[4303183].PDF Piima biokeemiline koostis Süsivesikud Laktoos, teisi süsivesikuid vähe Osmootne rõhk Vitamiinid Riboflaviin, vitamiin A, niatsiin… Koensüümid Mineraalained Raud, magnesium ,kaltsi...
Vähi tüüp Vähi biomarker ER (estrogen receptor), HER-2 (human epidermal growth factor receptor-2)[2], CA15-3 (cancer Rinnavähk antigen 15-3), BRCA-1, BRCA-2[11],CA 2729, uPA (urokinase plasminogen activator), PAI-1 (plasminogen activator inhibitor)[5] CA125 (cancer antigen 125)[2],hCG (human chorionic gonadotrophin)[11],HE4 (human epididymis Munasarja vähk protein 4), VEGF (Vascular Endothelial Growth Factor)[12] CEA (carcinoembryonic antigen)[2], CD133, CD24, CD29, CD44, CD166, EpCAM (epithelial cell Soolevähk adhesion molecule), ALDH1A1, ALDH1B1, Lgr5 (leucine-rich-repeat-containing G-protein- coupled receptor 5)[13] KRAS, EGFR (Epidermal Growth Factor Receptor), ALK (Anaplastic Lymphoma Kinase)[14], CEA Kopsuvähk
Prioonid Prioonid ehk priionid (mittesoovitav eestikeelne vorm prion) (tuleneb inglisekeelsest protein infectious (infection) particles) on viirustest väiksemad, ainult valgust koosnevad nakkushaigusetekitajad. Haiguse avastas ameeriklane Stanley Prusiner, mille ees sai ta 1997. aasta Nobeli preemia. Prioonid on normaalsete valkude nakkuslikud vormid, mis muudavad terveid valke endasarnasteks. Prioonid põhjustavad mitmeid neurodegeneratiivseid haigusi imetajatel: skreipi (inglise scrapie) lammastel, veiste käsnjas ajuhaigus ehk "hullu lehma" tõbi ja Creutzfeldti-Jakobi tõbi inimestel.
Kristina Raud YAGB-41 060290 10.04.07 Bioinformaatika ülesanded Fülogeneetilised puud. 1. DNA järjestuste fülogeneetiliste puude käsitsi koostamine kasutades kaugusmeetodeid (UPGMA, NJ). a. Moodustada antud 5 järjestuse kaugusmaatriks ning joonistada kvantitatiivne juurtega fülogeneetiline puu kasutades UPGMA meetodit. 1 ACAAACAGTT CGATCGATTT GCAGTCTGGG 2 ACAAACAGTT TCTAGCGATT GCAGTCAGGG 3 ACAGACAGTT CGATCGATTT GCAGTCTCGG 4 ACTGACAGTT CGATCGATTT GCAGTCAGAG 5 ATTGACAGTT CGATCGATTT GCAGTCAGGA Vastus: A B C D B 9 C 2 11 ...
Fast Food Ainiki Niinelaid & Kätlin Kaera Fast food definitions Fast food is the term given to food that can be prepared and served very quickly. Fast food - inexpensive food (hamburgers or chicken or milkshakes) Fast food - A type of meal that is often standardized, pre-prepared ; A type of food that is quickly made, but of low nutritional value; junk food; Anything standardized, quickly available, and inexpensive, often, of low value . Fast food - Foods designed for ready availability, use or consumption and sold at eating establishments for quick availability or take-out. Click to edit Master text styles Second level Third level Fourth level Fifth level Why is it so popular? You can buy fast food just about anywhere th...
It should be fun and should match your abilities. Studies show that the nation's trans fat levels have decreased over the past decade, mostly in part due to a controversial ban in New York City and dozens of other counties and towns across the country. If you are struggling to lower your trans fat levels due to health concerns, all you need to do is follow the simple rules set forth by these municipalities. Cut down on deep-fried or processed foods. Choose whole foods, like vegetables and lean protein. If you can't muster the willpower to order healthy when you eat out, try bringing your lunch from home instead of eating out. Healthy eating is not about strict nutrition philosophies, staying unrealistically thin, or depriving yourself of the foods you love. Rather, it’s about feeling great, having more energy, stabilizing your mood, and keeping yourself as healthy as possible—all of which can be achieved by learning some nutrition basics and using them in a way that works for you
tion. Muscle movement and metabolism within the cell, between cells, and between are associated with other diverse functions the muscle and the vascular system. such as aiding in movement of blood and The second largest component of muscle lymph and also in maintaining body tempera- is protein (U.S. Department of Agriculture ture. All of these functions are dependent 2008). Protein makes up an average of 18.5% on cellular metabolism and the ability of the of the weight of the muscle, though that cell to maintain energy supplies. Few cells figure can range from 16 to 22%. Proteins are required to generate as much force and
1. Mis on sidumissait? Mille poolest ta a) sarnaneb, b) erineb TATAbox- st? 2. Sidumissait - regioon (valgus, DNA-s jne), mis on spetsiifiliseks seostumiseks teistele molekulidele, ioonidele. It is a region on a protein, DNA, or RNA to which specific other molecules and ions -- in this context collectively called ligands, or more specifically, protein ligands -- form a chemical bond. 3. TATA-box is a DNA sequence (Cis-regulatory element) found in the promoter region of most genes in eukaryotes. It is the binding site of either transcription factors or histones and is involved in the process of transcription by RNA polymerase. It has the core DNA sequence 5'- TATAAA-3' or a variant, which is usually followed by three or more adenine bases and has been highly conserved through evolution. The TATA
Organismi ainevahetus ja happe-leelise seisund Tartu Ülikool 2016 Happe-leelis seisund •• Arteriaalse vere (plasma) pH juures 7,37 – 7,43 • Keskmine : pH 7,4 • Happelised ainevahetusproduktid lähevad verre. • Happe- leelis tasakaalu hoiavad konstantsena vere puhversüsteemid, gaasivahetus kopsudes ja eritusmehhanismid neerudes. • Kõrvalekalle normaalsest pH-st pärsib vajalike ensüümide aktiivsust Neerude pH regulatsioon •• Väljutab mittelenduvaid happeid (nt väävelhapet). • Normaalse toitumise korral produtseerib inimene 24h jooksul 12-15 mooli CO2-e ja uriiniga väljutatakse 50 mmol hapet uriiniga. • Suure happe liia korral on terve neer võimeline eritama ka rohkem vesinik ioone. • Aluselise liia korral vesinikioonide sekretsioon väheneb. • väljutatakse põhiliselt seotuna ja külge Neerude pH regulatsioon • Normaalsetes tin...
auch ihre Nahrung fressen möchten. Größe Tiere töten sie nur in Frühling und Herbst, vor und nach Winterschlaf, wenn sie ihre Stärke erholen. Braunbären fressen zuerst Zunge und Mumm, das Fleisch geht zum Altern. 5 5. Geburt Die Welpen werden in der Winterruhe geboren. Wenn Welpen geboren, sind sie nur halb Kilogramm schwer, blind und hilflos. Welpen saugen Muttermilch und sie wachsen schnell, weil Muttermilch 6 - 17% Protein und 20% Fettgehalt enthält. Im Frühling verlassen sie mit ihren Mutter zusammen, weil sie schon so stark sind. 6 6. Bedrohungen Viele Bären sterben an Mangelernährung oder Krankheiten. Braunbären Nahrung Konkurrenten sind Pumas, Luchse und Wölfe. Erwachsene Tiere haben nur ein Konkurrent Sibirischen Tiger. Menschen jagen Bären für Fell und meistens für Fleisch. Ihre Lebensräume sind auch bedroht, weil Menschen Müll in den Wäldern
LIPIIDIDE METABOLISM Rasvad · moodustavad 10-20 % imetajate kehamassist · moodustavad ~80 % loomse organismi energiavarust · paiknevad adipotsüütide (rasvarakkude) vakuoolides · katavad ca 1/2 südame, neerude, maksa ja skeletilihaste energiatarbest · sisalduvad taimede seemnetes kui esmane energiaallikas LIPIIDID KUI EFEKTIIVNE "KÜTUS" 70 kg kaaluva inimese keskmine"kütusevaru" Ainegrupp Üldine Energiasisaldus Üldine kcal Energiavaru sisaldus kcal/g % RASVAD 15,6 9 140 000 78 VALGUD 9,5 4 38 000 21 SÜSIVESI KUD 0,5 4 2 000 1 LIPIIDID - kontsentreerituim "kütus" rakkudele, kuna rasvhapetes on C aatomid enamsati vesinikuga maksimaalselt külla...
Bioloogia Gümnaasiumile I osa. Tartu: Eesti Loodusfoto. Valgud. http://et.wikipedia.org/wiki/Aminohapped 2.11.2008 17 SUMMARY Proteins with their many functions and structures are vital biopolymers to all bioorganisms including humans. They take part in almost every chemical reaction in our body and are especially important to organisms hormonic regulation. The term paper is divided into four chapters: proteins and their components, protein structures, protein structural classification and biofunctional assignments of proteins in the human body. Based on the information gathered from the term paper a conclusion, that no organism can function without proteins and that proteins are one of the reasons why bioorganisms exist. 18
keskkonna tingimuste muutusel · Peamised tüübid (võtmed): steroid retseptor zinc finger valgud leucine zipper (iga 7. on leu) Wendy Prioonid · Prions, which cause diseases such as Creutzfeldt-Jakob and BSE (Bovine spongiform encephalopathy, commonly called mad cow), are pretty scary stuff. They don't have any genetic material; instead, they're made from a protein that's normally produced by the brain. Like something out of science fiction, they adopt a distinct conformation, and then induce all the other proteins around them to adopt the same structure, gradually creating a tangle that's fatal to brain cells. Expose a healthy animal to the prions of a sick one, and the diseased form will gradually take over. · As if that weren't scary enough, evidence has been building that there are different strains of prions, presumably
sunflower oils for frying purposes, tends to enhance shelf life of snacks, and could be used as an ingredient of infant formulas requiring stability. B. Meal: Non-dehulled or partly dehulled sunflower meal has been substituted successfully for soybean meal in isonitrogenous (equal protein) diets for ruminant animals, as well as for swine and poultry feeding. Sunflower meal is higher in fiber, has a lower energy value and is lower in lysine but higher in methionine than soybean meal. Protein percentage of sunflower meal ranges from 28% for non-dehulled seeds to 42% for completely dehulled seeds. The color of the meal ranges from grey to black, depending upon extraction processes and degree of dehulling. C. Industrial Applications: The price of sunflower oil usually prohibits its widespread use in industry, but there are several applications that have been explored. It has been used in certain paints, varnishes
Cappimine- Kui RNAPolII on jõudnud sünteesida uuest transkriptist 25-30 nukleotiidi, siis 7metüülguanosiin ja teised 5'cap komponendid on juba mRNAde 5' otsa küljes. Seda algset staadiumi RNA protsessingus katalüüsib dimeerne capping ensüüm, mis seostub RNAPolII fosforüülitud CTDgaPolI- sünteesib ribosomaalset RNAd. CTD saba polII´l karboksüterminaalne domään, PolII- võib reguleerida väikesi tuuma RNAsid.PolII omab forforüleerivat karboksüterminaalset domääni.Osaleb lühikeste RNAde sünteesis( U6, 7s) Poly(A) saidid- elemendid ( konkreetsed järjestused) mille peale istub RNA sünteesi lõpetav/termineeriv kompleks lisatakse u 200bp adeniini saba. Pre-mRNA- 5'müts, eksonid, intronid, kaitsev 3' saba millel Poly(A) järjestus. Pre-mRNA allutatakse splaissingule-tekib küps mRNA mille tunnuseks on 5' cap ja 3' saba. RNProteins tunnevad ja detekteerivad RNAd tekib RNParticle. AG reegel- Ülavoolu: Int...
qid=201307 02051443AA7amYA https://celestialhealing.net/physicalveg3.htm https://www.peta.org/living/food/meat-contamination/ http://www.naturallyhealthyskin.org/anatomy-of-the-skin/ the-dermis/sweat-glands-and-lymph-nodes/ Used https://www.vivahealth.org.uk/wheat-eaters-or-meat-eaters/ length-digestive-tract sources 3 Week Artery Clearing Dietary Trial: http://dresselstyn.com/JFP_06307_Arti... Vegan Protein Levels Are Higher Study: http://www.sciencedirect.com/science/article/pii/S00652 42309470070 12 Weeks Diabetics Gone Vegan Trial: https://www.ncbi.nlm.nih.gov/pubmed/10446033 Vegans 16% less cancer Study:
Wörter 1. Die Gentechnik, -en - geenitehnoloogia 2. der Aminosauer, -äure- aminohape 3. die Biosynthese, -n - biosüntees 4. der Bakteriophag, -en - bakteriofaag 5. der Genexpression, -en - geeniekspressioon, -väljendumine 6. das Bronchialkarzinom, -e kopsuvähk 7. der Krebs, -e - vähk 8. die Epidemologie, -n -epidemoloogia 9. der Lungentumor, -en - kopsukasvaja 10. die Kanzerogene, -en - kantserogeen ( vähki põhjustav geen) 11. der Prävention, -en - ennetamine 12. der Antikörper- antikeha 13. der Biotransformation, -en - biotransformatsioon 14. die Enzyme, -en - ensüüm 15. ensymatisch- ensümaatiline 16. der Hämoglobin, -e - hemoglobiin 17. der Gerinnungsfaktor, -en - hüübimisfaktor 18. klonen- kloonima 19. die Genkartierung- geeni kaardistus 20. der Mikroorganismus- mikroorganism 21. die Zelle- rakk 22. der Allel- alleel 23. anaerob- anaeroobne 24. das Antigen, -e - antigeen 25. der Startcodon- star...
Oluline osa geenide regulatsioonis on enhaanseritel Enhaanseralade kasutamine (ja geenide aktivatsioon) sõltub rakus olevatest spetsiifilistest transkriptsioonifaktoritest Immuunrakkudel on retseptorite ja antikehade geenid, mis rekombineeritakse unikaalsel viisil Hamba arenguks on vaja paljude geenide koostöö Rakuvälised signaalid mõjutavad geenide ekspressiooni Eukaryotic cells have many different gene regulatory mechanisms A protein encoded from a gene may directly or indirectly affect its own gene activity (both positive or negative way) Transkriptsioonifaktori mitme seondumispiirkonna olemasolu geeni promootoris võimendab oluliselt transkriptsiooni taset Tuuma arhitektuur mõjutab geenide ekspressiooni
signaaljärjestusi. 2 tüüpi: (1) võivad olla järjestikused, (2) moodustada valgu eri osades selle pakkimise tulemusena. 15. Posttranslatoorsed modifikatsioonid. Atsetüleerimine (N--atsetüültransferaas); N-terminaalne metülatsioon; N-terminaalne müristoüleerimine; Lipiidide lisamine; C-terminaalne amidatsioon; glükosüleerimine, fosforüleerimine; GTP-d hüdrolüüsivad lülitid. Protein self-splicing mehhanism, kus aktiivne valk saadakse pärast valgu autokatalüütilist modifitseerimist lõigatakse välja osa järjestustest (intein) ja ligeeritakse ülejäänud valk kokku. II VALKUDE INTERAKTSIOONID 1. Ligand, sidumissait, afiinsus, dissotsatsioonikonstant. Ligand on valguga spetsiifiliselt interakteeruv molekul (polüpeptiid või mittevalguline)
inimene saab endale sobiva toode üles leida ja osta kas poes või interneti teel ning lihtsalt üles leida õige kasutusjuhend ja palju muud kasulikku . Eesti populaarsem fitnessi veebileht on www.fitness.ee mida toetavad Eestimaa tuntud kulturistid Ott Kiivikas jt. Toidulisandid pole inimesele vajalikud, aga nad teevad treeningud kergemaks ja mugavamaks ning lihasmassi ning rekordite kasvu kiiremaks. SUMMARY There is not enough protein and other ingredients in our everyday life that we need. To get them, humans produced dietary supplements. Dietary supplements are mostly used in sports as an extra resource with food, to get better results or increase muscle mass. The most popular supplements are creatine and protein. Creatine is a substance which gives muscles energy. Protein is a substance, which helps muscles grow and recover. Vitamines are also necessary for human body, that can be used as dietary supplements
short duration and high intensity. E.g. 100m sprint, 25m swim, smashing a tennis serve, lifting a weight upwards. · ATP-PCr can provide energy for 1 min of a brisk walk, a slow run for 20-30 seconds, and all-out sprinting for 6 to 8 seconds. Cont... · Quantity of high energy phosphates in muscle influences ability to generate all-out energy for brief durations · Longer duration performance, carbohydrates, fat, and protein provide necessary energy to recharge the pool of high energy phosphates · PCr reformation takes place only during recovery Task · Read through research article to answer the following: · What are the effects of different recovery duration of the levels of high energy phosphates? High-intensity Exercise Research · Bogdanis et al. (1995) 30 s sprint PCr = 19.7 and ATP = 70.5% of the resting values, muscle lactate was 11.9 mmol and muscle pH was