Vajad kellegagi rääkida?
Küsi julgelt abi LasteAbi
Logi sisse
Sulge

"protein" - 152 õppematerjali

protein - Cycling Diet by Dr. Ron Mignery (www.fourhourbody.com/protein-cycle) According to this book, available for free at this link, a single day per week of restricting protein to no more than 5% of maintenance calories can produce effects similar to extended caloric restriction.
Bioinformaatika kodutöö 2
1
doc

Bioinformaatika kodutöö 2

VAADELDAV VALK: Forkhead box protein O3 Transkriptide võrdlus Homo Sapiens FoxO3 järjestusega Kattuvad Organism Järjestuse ID Pikkus järjestused Identsed alused Tühikud Pan troglodytes Simpans ref|XM_003311514.2| 7946 1 7076/7133(99%) 18/7133(0%) Sumatra Pongo abelii Orangutan ref|XM_002817219.2| 7812 1 7190/7343(98%) 46/7343(0%) Gorilla gorilla gorilla Gorilla ref|XM_004044495.1| 7595 1 7024/7175(98%) 73/7175(1%) Macaca mulatta Reesusmakaak ref|XM_001093593.2| 7300 1 7079/7328(97%) 66/7328(0%) Papio anubis Anubis baboon ref|XM_003898343.1| 7775 1 7094/7353(96%) 60/7353(0%) Dasypus 4216/4873(8...

Informaatika → Bioinformaatika
28 allalaadimist
Järjestuste võrdlemine-otsingud andmebaasidest-BLAST-FASTA-SW-
23
doc

Järjestuste võrdlemine, otsingud andmebaasidest (BLAST, FASTA, SW).

EAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKVDANIAEQVIIQY GGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQAMKPGCTLFFLLCSALTVTTEAHAQTPDTA TTAPYLLAGAPTFDLSISQFREDFNSQNPSLPLNEFRAIDSSPDKANLTRAASKINENLYASTALERGTLKIKSI QMTWLPIQGPEQKAAKAKAQEYMAAVIRTLTPLMTKTQSQKKLQSLLTAGKNKRYYTETEGALRYVVADNGEKGL TFAVEPIKLALSESLEGLNKMTIQQWLFSFKGRIGRRDFWIWIGLWFAGMLVLFSLAGKNLLDIQTAAFCLVCLL WPTAAVTVKRLHDRGRSGAWAFLM VASTUS: Kasutasin programmi Protein-protein BLAST (blastp) Format ­ alignments 500 Sarnased järjestused Database: NCBI Protein Reference Sequences Posted date: Apr 9, 2006 5:23 AM Number of letters in database: 811,773,583 Number of sequences in database: 2,250,671 Lambda K H 0.319 0.133 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2250671 Number of Hits to DB: 127332226 Number of extensions: 4937094

Informaatika → Bioinformaatika
41 allalaadimist
Eating bugs
16
pptx

Eating bugs

Africa, Asia, and Latin America Winged termites are collected and fried, roasted, or made into bread. With cornmeal porridge. Beekeepers are considered virile, because they regularly eat larvae from their beehives De-winged dragonflies boiled in coconut milk with ginger and garlic. The agave worm, is eaten on tortillas and placed in bottles of mezcal liquor. Casu marzu- riddled with live insect larve, also called a rotten cheese. In Europe and USA it´s not popular. Why it´s good? Protein, but also vitamins, minerals, and fats. Crickets are high in calcium, and termites are rich in iron. Hamburger-18% protein and 18% fat. Cooked grasshopper- 60% protein and 6% fat. 45 kgs of feed produces 4.5 kgs of beef but 20 kgs of cricket. Products which can contain insects Canned citrus frukt juices- Insects and insect eggs 5 or more and other fly eggs per 250 ml or 1 or more maggots per 250 ml Chocolate and chocolate liquor- Insect filth, 60 or more insect fragments per 100 grams

Keeled → Inglise keel
4 allalaadimist
FOOD FOR SPORT
2
docx

FOOD FOR SPORT

FOOD FOR SPORT Eating right can help energize your workout. What is the best thing to eat before exercising for energy and endurance? You need quality carbs, lean protein, heart-healthy fats, and fluids. Your muscles rely on carbohydrate foods like breads, cereals, pasta, rice, fruits, and vegetables for quick energy. You need protein for your muscles and for your blood cells, which bring nutrients and oxygen to your muscles. You also need fluids, or your body will have a hard time performing at its best. Is there an ideal meal to eat before exercise? There's no one meal that you need to eat before working out. Instead, focus on these 5 things: Low fat Moderate in carbs and protein Low fiber Includes fluids Made up of familiar foods that you tolerate well

Keeled → Inglise keel
1 allalaadimist
Darja Lavõgina 3
3
docx

Darja Lavõgina 3

Magistriõpe 2003 - 2006 Tartu Ülikool, Füüsika- keemiateaduskond, keemia eriala, Bakalaureuseõpe Teadusorganisatsiooniline 2006 - ... Eesti Biokeemia Seltsi liige ja -administratiivne tegevus Teaduskraadi info Darja Lavõgina, doktorikraad, 2010, (juh) Asko Uri, Development of protein kinase inhibitors based on adenosine analogue-oligoarginine conjugates, Tartu Ülikool, Loodus- ja tehnoloogiateaduskond, Tartu Ülikooli Keemia Instituut Darja Lavõgina, magistrikraad, 2007, (juh) Asko Uri, Protein Kinase-Bisubstrate

Ühiskond → Ühiskond
3 allalaadimist
Report about students eating habits
1
docx

Report about students eating habits

Fast food can wreak havoc on your health if you aren't careful. Limit stops at fast food restaurants, and when you do go, bypass the French fries and other fried treats. Order salads, sandwiches that don't contained fried or greasy meat, and baked potatoes. Select pizza healthy pizza toppings, such as olives, mushrooms and green peppers. If you must have meat, opt for Canadian bacon, which is much lower in fat than pepperoni. Even college students need a balanced diet of protein, vitamins, minerals, carbohydrates and fats. Eat a variety of vegetables and moderate amounts of protein. Limit fats to the healthier choices, such as olive oil and nuts. for decades, vending machines have been the bane of many college students. They also carry the responsibility for the unhealthy "freshman fifteen," referring to the number of pounds college students often put on their first year at college. If you keep healthy snacks, such as raw veggies, yogurt and

Keeled → Inglise keel
13 allalaadimist
The advantages and disadvantages of being a vegetarian
1
doc

The advantages and disadvantages of being a vegetarian

life. Comparing with the past, the variety of different nonanimal products available has increased considerably and is sufficient to provide a healthy diet. However, it can be said there are both advantages and disadvantages for deciding to be a vegetarian. Firstly, vegetarians feel that there are certain advantages to be gained by not eating meat. They consider substitute foods such as soya, cereals and vegetables to be an even better source of protein than meat. It is maintained that such foods are low in fat and cholesterol, therefore promoting better health. Finally, by avoiding meat, vegetarians believe they are not eating contaminated food which is often a source of many illnesses. On the other hand, some people feel that being a vegetarian also has disadvantages. For example, such a diet can be boring and tasteless. Moreover, the choice of food available is often limited when eating out

Keeled → Inglise keel
38 allalaadimist
Can food really affect our mental well-being
1
odt

Can food really affect our mental well-being?

movement a major effort filled with stress and pain. When people are hungry that means their blood sugar dropped,they feel tired,irritable and depressed and starvation.They're becoming more agressive to things around them.Solution for that is eating regularly and choosing foods that release energy slowly will help to keep sugar levels steady. I think food affects our well-being,because is one of the important thing for our body. Food gives substances like vitamines,minerals,carbohydrates and protein to our body. When people starving,they feel weakness in their body,because their body don't get enough substances.Then immunity becomes weaker,if body don't get enough minerals then their bones becomes also weaker and are easly breakable.Food helps to raise people mood and I agree with it.It depends what people eat, if people eat food that consists few substances they still will be feeling starvation.People must eat that kind of meal that consists protein,carbohydrate and fat.If body gets

Keeled → Inglise keel
3 allalaadimist
Inglise keel unit 5 answers
276
docx

Inglise keel unit 5 answers

1. (a) (i) gene length of DNA; codes for a (specific), polypeptide / protein / RNA; max 1 allele alternative form of a gene; found at a, locus / particular position on, a chromosome; max 1 (ii) assume allele refers to coat colour allele (coat colour) gene / alleles, only on X chromosome; A no (coat colour), gene / allele, on Y chromosome male cats, XY / only have one X chromosome;

Keeled → Inglise keel
13 allalaadimist
SPORDI KVALITEEDI UURIMINE
42
docx

SPORDI KVALITEEDI UURIMINE

, . , , . . 34 1.4.7 13. , . , . , . [13] . . 13 ­ , . 36 2. : , , . : : Optimum Nutrition (), Myprotein () Syntrax (). 2.1.1 1 1 Optimum Nutrition 100% Whey Gold Standard 0.04 Myprotein Protein Pancake Mix 0.08 Syntrax Nectar sweets 0.05 100 «Optimum Nutrition» 78.5 , 5.8 3.8 . . . 3. 100 «Myprotein» 69 , 12 6.4 . , . . 3. 100 «Syntrax» 82.1 , 0 0 . . . 3. : «Syntrax», 100 82 , ­ «Myprotein», 100 69 . 38 2.2

Keeled → Vene keel
1 allalaadimist
Food Microstructure and Starch Digestion
2
pdf

Food Microstructure and Starch Digestion

For example it is reported that in potatoes that have higher strach content and closely packed cell arrangement, the fracturability is higher. Cooking or just thermal heating starch leads to an increase of hydrolysis and therefore makes it easier for enzymatic attack in the gastrointestinaal tract. Slide 6 Starch digestion is also different in various foods with diferent components. Proteins that attaches to starch granules may make harder to digest starch. Cooking starch with protein may also reduce effectness of digestion. Protein forms around starch and it is harder to break through to starch. Ohter study found out that adding sodium sulphite to starch can prevent enzyme-resistant polymers that increase the speed of digestion because amylotic enzymes can easily hydrolyse starch. Removing gluten may also work to increase digestion time, but adding it back doed not reverse the reaction. Slide 7 This study found out how important is starch in our everyday life

Keeled → inglise teaduskeel
1 allalaadimist
LUTSERNI SEGUKÜLVI BOTAANILISE KOOSSEISU MÕJU ROHUSÖÖDA KVALITEEDILE
6
pdf

LUTSERNI SEGUKÜLVI BOTAANILISE KOOSSEISU MÕJU ROHUSÖÖDA KVALITEEDILE

NDF, decreased CP, DDM, ME. Especially in the first cut the quality declines rapidly when the forage biomass increases. Dynamics of quality changes depended on the speed of species' seasonal development. Botanical composition of lucerne-grass mixtures showed positive correlation between percent of lucerne and CP (r = 0,73; p < 0,05) and negative correlation between percent of lucerne and NDF (r = -0,55; p < 0,01). The harvests of the lucernes had positive protein balance values (PBV) in the rumen. The PBV was decreased close to zero in the `Karlu`/`Molisto`, `Karlu´/`Darimo` and `Karlu`/`Lincoln` mixtures of the first cut. Hybrid lu- cerne ´Karlu´ was more persistent in the mixtures compared to common lucerne ´FSG 408 DP´. Keywords: crude protein (CP), dry matter digestibility (DDM), metabolizable energy (ME), neutral-detergent fiber (NDF) Uno Tamm, Paul Lättemäe, Silvi Tamm, Estonian Research Institute of Agriculture, 13 Teaduse St

Põllumajandus → Agronoomia
12 allalaadimist
Valgu kontsentratsiooni määramine Bradfordi meetodil
7
docx

Valgu kontsentratsiooni määramine Bradfordi meetodil

proo kontsentratsioon absorptsioon v 1 1 mg/ml 0,51 2 0,5 mg/ml 0,47 3 0,2 mg/ml 0,43 4 0,1 mg/ml 0,38 5 0,05 mg/ml 0,36 6 tundmatu 0,49 Kaliibrimiskõvera järgi võib öelda, et tundmatu valgu kontsentratsiooniks oli 0,75 mg/ml. Viited: 1. Bradford, M. A rapid and sensitive method for the quantitation of microgram quantities of protein utilizing the principle of protein-dye binding. Anal. Biochem. (1976) 72, 248-254. 2. Compton SJ, Jones CG. Mechanism of dye response and interference in the Bradford protein assay. Anal. Biochem. 1985 Dec;151(2):369-74

Bioloogia → Genoomika ja proteoomika
59 allalaadimist
Eating habits
1
doc

Eating habits

porridge, sandwich and drink cup of tea. My eating habits are healty because i care what i eat. I am sportman and i have control what i consume. I eat every kind of foods: meat, fish, fruits and vegetables. My favorite food is rice wiht pineapple and chichen sauce. My favorite dessert is pancakes with chocolate cream. Healty eatings are if people eat normally about 3-4 times a day. People must eat every kind of food: meat, fish, fruits, vegetables and consume every kind of nutrients: protein, fat, carbohydrate and gluvose. Draw a conclusion from my eating habits and healty eating habits. People must consume every kind of foods and nutrients. Keith Stseglov 11.c

Keeled → inglise teaduskeel
10 allalaadimist
The Theory of Human Motivation
18
pdf

The Theory of Human Motivation

Behaviorism (behavior can be studied and explained) Humanism (the human dimension of psychology) Transpersonal psychology (hippie psychology) Hierarchy of human needs http://en.wikipedia.org/wiki/Maslow's_hierarchy_of_needs D-needs and B-needs Basic needs (D = deficit) physiological safety beloning esteem Higher need (B = being) self actualization What a man can be, he must be! Physiological needs Homeostasis oxygen water protein salt, sugar, calcium ... In Maoist China the most basic need was belonging Safety, love and esteem Stability, structure, order Community, affection Status, dignity, reputation Once the D-needs are satisfied they are no longer motivating. Beyond basic needs What a man can be, he must be! Self-actualization, being need Depends on the satisfication of D-needs Never fully satisfied Thank you! Questions?

Keeled → Inglise keel
2 allalaadimist
A formal letter
1
docx

A formal letter

In my family people drink alcohol only on birthdays or other celebratings like New Year. In my family all but grandfather smoke . I am the only one who does some kind of sport. In winter i often go swimming with my best friend , two times a week. In autumn and summer i go cycling or jogging. I like to keep me fit. Sad that other people in my family do not play sports at all. I like to eat the food that my granny makes for me. But i try not to eat much and unhealthy. Now i eat much vitamins and protein. A school child must eat about 2000-2500 calories at day , nut ii cant believe that we all eat so much. We all must look what we eat and how much we eat and we will be healthy. Your Sincerely Kristina

Keeled → Inglise keel
26 allalaadimist
Terminid
14
pptx

Terminid

Terminid · SNARE, soluble N-ethylmaleimide sensitive factor adaptor protein; · Receptors TMD, Trans-membrane domain; · PR, Pathogenesis-related; · qRT-PCR, quantitative Real Time PCR; · CDD, Conserved Domain Database; · HMM, Hidden Markov Model; · MSA, Multiple sequence alignment; · PDB, Protein Data Bank; · DOPE, Discrete Optimized Protein Energy; · MOF, MODELLER Objective Function; · NILs, Near-isogenic lines · Leaf rust; · Ustilago maydis, maisinõe seen · bread wheat, Triticum suvitrühvel L · tobacco, Nicotiana tabacum · oder, Hordeum vulgare · riis O. riis indica · nr: mitte ülearune; · S-PI, susceptible patogeen nakatunud, · S-M, susceptible negative control; · GAPDH Glütseraaldehüüd-3-Fosfaat Dehüdrogenaas 3.5. SNARE geenide up-regulation leherooste nakkuse ajal nisus

Keeled → Inglise keel
2 allalaadimist
For and Against Fast Food
2
docx

For and Against Fast Food

For and Against Fast Food All people in the world need food, most popular is fast food and it is mace you feel good. Is it good or bad? Fast food is taste good, you will enjoy eating it. You can get it fast, “restaurants” are everywhere. Fast food is cheaper than a self-made food. Most popular and well-known fast food “restaurants” are “Mac Donalds” and Burger King. However are it is healthy? Most important that human body need protein, carbohydrates and fiber to stay alive. But it is not a enough, have to by also vitamins, minerals and lot of other substances . If you are hungry it is better to eat chunk, then by whit out food. Fast food dos not offer diverse and healthy food. Also there are contains a which is make addictive for it. Human can eat every kind of food, but you have to change it all the time, cant stuck on the same stuff. Some test saw, what happened them who eat chunk food every day, but my opinion is same

Keeled → Inglise keel
6 allalaadimist
Põhjalik referaat valkude kohta
18
doc

Põhjalik referaat valkude kohta

acid residues. Like other biological macromolecules, proteins are essential parts of organisms and participate in every process within cells. Many proteins are enzymes that catalyze biochemical reactions and are vital to metabolism. Most proteins are fold into unique 3- dimensional structures such as primary structure, secondary structure, tertiary structure and quaternary structure. The best-known role of proteins in the cell is as enzymes, which catalyze chemical reactions. Your body uses the protein you eat to make lots of specialized protein molecules that have specific jobs. For instance, your body uses protein to make haemoglobin, the part of red blood cells that carries oxygen to every part of your body. Other proteins are used to build cardiac muscle. Proteins have very important functions in our body. 17 Kasutatud materjal Grandberg, Igor. 1979. Orgaaniline Keemia. Tallinn: Kirastus Valgus Männik, A. 1985. Biokeemia

Bioloogia → Bioloogia
138 allalaadimist
Balanced Diet Healthy Lifestyle
26
pptx

Balanced Diet Healthy Lifestyle

Meat, fish and dairy: take something from this group Fruit and vegetables: take 5 portions a day from this group Carbohydrates: take most food from this group (rice, pasta, bread, potatoes) The Main Food Groups Vegetables and Pulses Vegetables are rich in vitamins and minerals. Pulses are a source of protein and mono unsaturated fatty acids, essential for body. You can consume boiled or cooked vegetables one or two bowls daily. Take 5 a day everyday! For lunch you can have the following list of vegetables... · Lettuce · Cabbage · Cauliflower · Beans · Broccoli · Lentils · Spinach · Bitter gourd · Tomato · Okra · Carrot Fruits

Keeled → Inglise keel
7 allalaadimist
To be or not to be a vegeterian
1
doc

To be or not to be a vegeterian

To be or not to be a vegeterian To be or not to be a vegeterian, that is the question. there are many positive and negative sides of being a vegeterian but what are they? First of all, many people think that being vegeterian is helthy but is it? Eating always plants does not give us protein that is wery important to our health. Secondly, vegetables does not give us fat, what is very important to keep warm and without it our kidneys run around in our body, and it is painful. It is clear, that for life we need many more nutritions, what we can get from green food. On the other hand it is healthy to be a vegeretian. People, who does not eat meat are fit and this is healthy. Our heart can work well and vegeterians dont need to worry about

Keeled → Inglise keel
20 allalaadimist
Aminohapete vajadused loomadel
22
pptx

Aminohapete vajadused loomadel

Aminohapete süntees ja vajadused erinevatel loomaliikidel Richard Riispere Eesti Maaülikool 5.12.2014 Sissejuhatus • Aminohapped -> Valgud 22 Standardset aminohapet http://en.wikipedia.org/wiki/Protein#Nutrition • Loomad ei suuda ise sünteesida kõike 22-te aminohapet. • Aga nt. proliini suudab organism ise sünteesida, pole vaja omandada. (Osborne,T.B, Mendel,L.B, 1914:326) http://glossary.periodni.com/images/proline.jp • Vajalikke aminohappeid ei suuda loom ise sünteesida. Nt. aspartokinaas • Liikide erinevus ei seisne ainult füsioloogilistes erinevusest, vaid ka vanusest. http://www.allaboutwildlife.com/wp-

Keemia → Biokeemia
3 allalaadimist
Molekulaar- ja rakubioloogia konspekt
20
docx

Molekulaar- ja rakubioloogia konspekt

resistance can spread by means of transposons. Also called jumping gene. · Trasktriptsiooni faktori sidumissait - Sidumissait on ala DNA-l, millele transkriptsioonifaktor seondub. Regioon (valgus, DNA-s jne), mis on spetsiifiliseks seostumiseks teistele molekulidele, ioonidele. · Speiser - geenide vaheline ala. Puuduvad prokarüootsetes geenides. · TBP - The TATA-binding protein (TBP) is a general transcription factor that binds specifically to a DNA sequence called the TATA box. Kuulub TFIID kompleksi. TBP is a subunit of the eukaryotic transcription factor TFIID. TFIID is the first protein to bind to DNA during the formation of the pre-initiation transcription complex of RNA polymerase II. TBP is also a necessary component of RNA polymerase I and RNA

Bioloogia → Molekulaar - ja rakubioloogia...
186 allalaadimist
Neurobioloogias sönade seletus-ingl keelne
9
doc

Neurobioloogias sönade seletus, ingl keelne

EFFERENT – Carrying information away from a particular group of neurones ENDOCRINE GLAND – An organ which produces and secretes a hormone* directly to the bloodstream. ENDORPHINS - A group of neuropeptide transmitters which are produced in the CNS and bind to opioid receptors; they regulate the perception of pain ENKEPHALINS – A group of neuropeptide transmitters which are produced in the CNS and bind to opioid receptors; they regulate the perception of pain. ENZYME – A protein which has the ability to control a chemical reaction within a cell. EPINEPHRINE (SEE ADRENALINE) ESTROGENS – A group of sex hormones* more abundant in females than males. The brain contains numerous oestrogen receptors which is consistent with a hypothesis that estrogens play a neuroprotective role. EXCITATION – An influence of one neurone on another which facilitates an action potential. EXCITATORY POSTSYNAPTIC POTENTIAL (EPSP) – A change in local potential

Psühholoogia → Psühholoogia
31 allalaadimist
Bees
1
docx

Bees

Bees are flying insects closely related to wasps and ants. There are nearly 20,000 known species of bee, in nine recognized families, though many are undescribed and the actual number is probably higher. They are found on every continent except Antarctica, in every habitat on the planet that contains insect-pollinated flowering plants. Bees are adapted for feeding on nectar and pollen, the former primarily as an energy source, and the latter primarily for protein and other nutrients. Most pollen is used as food for larvae. Bees have a long proboscis (a complex "tongue") that enables them to obtain the nectar from flowers. They have antennae almost universally made up of 13 segments in males and 12 in females, as is typical for the superfamily. Bees all have two pairs of wings, the hind pair being the smaller of the two; in a very few species, one sex or caste has relatively short wings that make flight difficult or impossible, but none is wingless.

Keeled → Inglise keel
6 allalaadimist
The 4-Hour Body - An Uncommon Guide to Rapid Fat-Loss-Incredible Sex-and Becoming Superhuman - Timothy Ferriss
574
pdf

The 4-Hour Body - An Uncommon Guide to Rapid Fat-Loss, Incredible Sex, and Becoming Superhuman - Timothy Ferriss

many of the world's best athletes and scientists. This puts me in a rather unusual position. I'm able to pull from disciplines and subcultures that rarely touch one another, and I'm able to test hypotheses using the kind of self-experimentation mainstream practitioners can't condone (though their help behind the scenes is critical). By challenging basic assumptions, it's possible to stumble upon simple and unusual solutions to long-standing problems. Overfat? Try timed protein and pre-meal lemon juice. Undermuscled? Try ginger and sauerkraut. Can't sleep? Try upping your saturated fat or using cold exposure. This book includes the ndings of more than 100 PhDs, NASA scientists, medical doctors, Olympic athletes, professional sports trainers (from the NFL to MLB), world-record holders, Super Bowl rehabilitation specialists, and even former Eastern Bloc coaches. You'll meet some

Keeled → Inglise keel
20 allalaadimist
Tuberkuloos
20
pptx

Tuberkuloos

MDR­TB testi (määratakse tundlikkus  amikatsiini, kanamütsiini, kapreomütsiini,  ofloksatsiini ja protionamiidi suhtes)  Quantiferon­TB test TUBERKULIINI TEST  Võimaldab kindlaks teha tuberkuloosse  infektsiooni olemasolu organismis.   Positiivne tuberkuliintest viitab ainult infektsiooni  olemasolule. Haigust (tuberkuloosi) ei pruugi olla.   Tuberkuliin on M. tuberculosis’e antigeen ­ PPD  (Purified Protein Derivate). Oma olemuselt on see  tuberkuloosibakterite kultuuri steriliseeritud  pretsipitaat.   Tuberkuliini süstitakse 2 TÜ nahasisesi käsivarre  keskmisele kolmandikule.   Reaktsiooni ­ paapuli diameetrit ­ hinnatakse 72  tunni pärast mõõtes risti käsivarre pikiteljega.  PROFÜLAKTIKA  Bacillus Calmette­Guérin (BCG) on üks enim  kasutatavaid vaktsiine  Riikides kus  tuberkuloosi vastu vaktsineerimine 

Meditsiin → Meditsiin
6 allalaadimist
Eating habits in Estonia
1
docx

Eating habits in Estonia

Other popular drinks are kali and liquor Vana Tallinn. Many newspapers say young Estonian people have bad eating habits. The breakfast should be relatively rich in carbohydrates (k.bha.drets) , body waits in the morning to get carbohydrates (k.bha.drets) and the constant influx of nutrients is necessary. Lunch at the school canteen is served balanced food. Even buns are better than nothing. A bun consists of nutrients, mostly carbohydrates(k.bha.drets), less protein and fat. Dinner is the last meal time. It should consist of fruit and vegetables and be poor with carbohnydrates (k.b ha.drets). It is not unhealthy when you eat at 7 p.m., if you are active at least till 9 p.m.

Keeled → Inglise keel
13 allalaadimist
Renewable energy
8
ppt

Renewable energy

Can't be replenished Most of our energy. May cause global warming. Wind energy is the fastest growing. Most renewable energy comes from the sun. Hydroelectric energy is the oldest and largest source. Renewable energy a.k.a "green" energy. Thank you for listening! We use energy every day. It surrounds us in different forms, such as light, heat, and electricity. Our bodies use the energy stored in molecules of substances like carbohydrates and protein to move, breathe, grow, and think. We also use energy to do work and to play. Humans have invented thousands of machines and appliances that use energy to make our work easier, to heat our homes, and to get ourselves from place to place. Some of these machines use electricity, while others, like automobiles, use the energy stored in substances such as gasoline. Renewable energy is energy generated from natural resources such as sunlight, wind, rain, tides, and

Keeled → Inglise keel
12 allalaadimist
Piim-selle tekkimise keemiline protsess-biokeemiline koostis-erinevas vanuses ja erinevatel imetajatel
20
pptx

Piim, selle tekkimise keemiline protsess, biokeemiline koostis, erinevas vanuses ja erinevatel imetajatel

Ülejäänud koostisosad verest ilma märkimisväärsete muutusteta Kasutatud materjalid http://www.federica.unina.it/agraria/animal-production/milk-production/ http://vana.eestiloodus.ee/loodusesober/artikkel237_225.html http://entsyklopeedia.ee/artikkel/ternespiim http://www.khuisf.ac.ir/prof/images/Uploaded_files/DairyChemistryAndBiochemistry_muyac[4303183].PDF https://en.wikipedia.org/wiki/Mammary_gland https://extension.psu.edu/milk-components-understanding-milk-fat-and-protein-variation-in-your-dairy-herd http://pediatrics.aappublications.org/content/116/3/e432 https://www.slideshare.net/irshad2k6/factors-affecting-quality-and-quantity-of-milk-in-dairy-cattle https://en.engormix.com/dairy-cattle/articles/factors-affecting-milk-composition-t35400.htm http://online.liebertpub.com/doi/abs/10.1089/bfm.2012.0035?url_ver=Z39.88-2003&rfr_id=ori%3Arid %3Acrossref.org&rfr_dat=cr_pub%3Dpubmed& https://en.wikipedia.org/wiki/Casein Zilmer, M., Kareson, E., Vihalemm, T

Keemia → Biokeemia
5 allalaadimist
Vähi biomarkerid
5
doc

Vähi biomarkerid

Vähi tüüp Vähi biomarker ER (estrogen receptor), HER-2 (human epidermal growth factor receptor-2)[2], CA15-3 (cancer Rinnavähk antigen 15-3), BRCA-1, BRCA-2[11],CA 27­29, uPA (urokinase plasminogen activator), PAI-1 (plasminogen activator inhibitor)[5] CA125 (cancer antigen 125)[2],hCG (human chorionic gonadotrophin)[11],HE4 (human epididymis Munasarja vähk protein 4), VEGF (Vascular Endothelial Growth Factor)[12] CEA (carcinoembryonic antigen)[2], CD133, CD24, CD29, CD44, CD166, EpCAM (epithelial cell Soolevähk adhesion molecule), ALDH1A1, ALDH1B1, Lgr5 (leucine-rich-repeat-containing G-protein- coupled receptor 5)[13] KRAS, EGFR (Epidermal Growth Factor Receptor), ALK (Anaplastic Lymphoma Kinase)[14], CEA Kopsuvähk

Meditsiin → Patoloogia
15 allalaadimist
Prioonid ehk nakkushaigusetekitajad
2
doc

Prioonid ehk nakkushaigusetekitajad

Prioonid Prioonid ehk priionid (mittesoovitav eestikeelne vorm prion) (tuleneb inglisekeelsest protein infectious (infection) particles) on viirustest väiksemad, ainult valgust koosnevad nakkushaigusetekitajad. Haiguse avastas ameeriklane Stanley Prusiner, mille ees sai ta 1997. aasta Nobeli preemia. Prioonid on normaalsete valkude nakkuslikud vormid, mis muudavad terveid valke endasarnasteks. Prioonid põhjustavad mitmeid neurodegeneratiivseid haigusi imetajatel: skreipi (inglise scrapie) lammastel, veiste käsnjas ajuhaigus ehk "hullu lehma" tõbi ja Creutzfeldti-Jakobi tõbi inimestel.

Bioloogia → Bioloogia
23 allalaadimist
Bioinformaatika arvestus ül
21
doc

Bioinformaatika arvestus ül

060290 transformed into a tree by fitch, kitsch or neighbor program. Programs dnadist and protdist create a file "outfile". Before running fitch, kitsch ot neighbor, "outfile" should be renamed, either as "infile" ot with another file name. Fitch, kitsch and neighbor programs create both "outfile" and "outtree". dnadist -DNA distance matrix calculation protdist -Protein distance matrix calculation fitch -Fitch-Margoliash tree drawing method without molecular clock kitsch -Fitch-Margoliash tree drawing method with molecular clock neighbor -Neighbor-Joining and UPGMA tree drawing method Character based methods These programs read in the sequence alignment, and produce either one or multiple trees in the output files "outfile" and "outtree". dnapars -DNA parsimony dnapenny -DNA parsimony using branch-and-bound

Informaatika → Bioinformaatika
38 allalaadimist
Fast food
8
pptx

Fast food

foods with trans fat, and many have menu items that contain fruits and vegetables. If you are having fast food more than once a week, try to make healthier choices. Where can I find nutrition facts about fast food? Most fast food and restaurant chains post their nutrition information online. Use a search engine to find the companies web page. There is usually a link to the nutrition section on the home page where you will find nutrition facts, including fat, cholesterol, sodium, protein, calories, and more. Take a look at this information to help you make healthier choices when eating out. Thank you for listening!!!

Keeled → Inglise keel
7 allalaadimist
HEALTHY LIFESTYLE
2
docx

HEALTHY LIFESTYLE

It should be fun and should match your abilities. Studies show that the nation's trans fat levels have decreased over the past decade, mostly in part due to a controversial ban in New York City and dozens of other counties and towns across the country. If you are struggling to lower your trans fat levels due to health concerns, all you need to do is follow the simple rules set forth by these municipalities. Cut down on deep-fried or processed foods. Choose whole foods, like vegetables and lean protein. If you can't muster the willpower to order healthy when you eat out, try bringing your lunch from home instead of eating out. Healthy eating is not about strict nutrition philosophies, staying unrealistically thin, or depriving yourself of the foods you love. Rather, it’s about feeling great, having more energy, stabilizing your mood, and keeping yourself as healthy as possible—all of which can be achieved by learning some nutrition basics and using them in a way that works for you

Keeled → Inglise keel
2 allalaadimist
Liha töötlemine
1168
pdf

Liha töötlemine

tion. Muscle movement and metabolism within the cell, between cells, and between are associated with other diverse functions the muscle and the vascular system. such as aiding in movement of blood and The second largest component of muscle lymph and also in maintaining body tempera- is protein (U.S. Department of Agriculture ture. All of these functions are dependent 2008). Protein makes up an average of 18.5% on cellular metabolism and the ability of the of the weight of the muscle, though that cell to maintain energy supplies. Few cells figure can range from 16 to 22%. Proteins are required to generate as much force and

Keeled → Inglise keel
22 allalaadimist
Molekulaarbioloogia II osa
8
docx

Molekulaarbioloogia II osa

1. Mis on sidumissait? Mille poolest ta a) sarnaneb, b) erineb TATAbox- st? 2. Sidumissait - regioon (valgus, DNA-s jne), mis on spetsiifiliseks seostumiseks teistele molekulidele, ioonidele. It is a region on a protein, DNA, or RNA to which specific other molecules and ions -- in this context collectively called ligands, or more specifically, protein ligands -- form a chemical bond. 3. TATA-box ­is a DNA sequence (Cis-regulatory element) found in the promoter region of most genes in eukaryotes. It is the binding site of either transcription factors or histones and is involved in the process of transcription by RNA polymerase. It has the core DNA sequence 5'- TATAAA-3' or a variant, which is usually followed by three or more adenine bases and has been highly conserved through evolution. The TATA

Bioloogia → Molekulaar - ja rakubioloogia...
95 allalaadimist
Organismi ainevahetus ja happe-leelise seisund
24
pptx

Organismi ainevahetus ja happe-leelise seisund.

• Aminohapete metabolismist tekkinud happed Kasutatud kirjandus 1. R.F.Schmidt G. Thews, Inimese füsioloogia, Tartu, 1997.      Peatükid 2.6, 15, 17.1  2. Pocock G. Human Physiology: The Basis of Medicine. Oxford University Press. 2004,2006.  3. Guyton and Hall Textbook of Medical Physiology (Guyton Physiology) 4. Glutamaadi deamineerimise pilt: http://2012books.lardbucket.org/books/introduction-to-chemistry- general-organic-and-biological/s23-07-stage-ii-of-protein-catabolism.html 5. Happe-leelis tasakaalu pilt: http://www.precisionnutrition.com/all-about-dietary-acids-and-bases

Meditsiin → Farmakoloogia
17 allalaadimist
Braunbär
9
doc

Braunbär

auch ihre Nahrung fressen möchten. Größe Tiere töten sie nur in Frühling und Herbst, vor und nach Winterschlaf, wenn sie ihre Stärke erholen. Braunbären fressen zuerst Zunge und Mumm, das Fleisch geht zum Altern. 5 5. Geburt Die Welpen werden in der Winterruhe geboren. Wenn Welpen geboren, sind sie nur halb Kilogramm schwer, blind und hilflos. Welpen saugen Muttermilch und sie wachsen schnell, weil Muttermilch 6 - 17% Protein und 20% Fettgehalt enthält. Im Frühling verlassen sie mit ihren Mutter zusammen, weil sie schon so stark sind. 6 6. Bedrohungen Viele Bären sterben an Mangelernährung oder Krankheiten. Braunbären Nahrung Konkurrenten sind Pumas, Luchse und Wölfe. Erwachsene Tiere haben nur ein Konkurrent ­ Sibirischen Tiger. Menschen jagen Bären für Fell und meistens für Fleisch. Ihre Lebensräume sind auch bedroht, weil Menschen Müll in den Wäldern

Keeled → Saksa keel
5 allalaadimist
Lipiidide metabolism
3
doc

Lipiidide metabolism

· HC03-(C02) · NADPH+H+ - redutseerija · ATP - energiakandja · Rasvhapete süntaas - multiensüümkompleks Rasvhapete süntaas koosneb kuuest erinevast ensüümvalgust ja ACP-st (bakteritel ja taimedel) või ühest suurest multifunktsionaalsest valgust (selgroogsetel), mis omab seitset erinevat ensüümaktiivsust; sisaldab kahte -SH rühma, mis seovad makroergilise tioestersidemega rasvhapete atsüüle. ACP ehk ACP-SH (acyl carrier protein) - atsüülikandev valk; väikese molekulmassiga valk, mis toimib kui sünteesi vaheühendite kandja. LIPOGENEESI STAADIUMID · Malonüül-KoA süntees lähtuvalt atsetüül-KoA-st ja HCO3 --st NB! Viimaselt pärineb ­COO- ! Sünteesi katalüüsib ensüüm atsetüül-KoA karboksülaas. · Seostumine rasvhapete süntaasiga -SH rühmade kaudu · Ahela kasv kahe süsiniku aatomi lisandumise teel neljaetapilise sünteesi käigus; süsiniku doonoriks on malonaat, CO2 vabaneb.

Keemia → Biokeemia
81 allalaadimist
Valkudereferaat
18
doc

Valkudereferaat

Bioloogia Gümnaasiumile I osa. Tartu: Eesti Loodusfoto. Valgud. http://et.wikipedia.org/wiki/Aminohapped 2.11.2008 17 SUMMARY Proteins with their many functions and structures are vital biopolymers to all bioorganisms including humans. They take part in almost every chemical reaction in our body and are especially important to organisms hormonic regulation. The term paper is divided into four chapters: proteins and their components, protein structures, protein structural classification and biofunctional assignments of proteins in the human body. Based on the information gathered from the term paper a conclusion, that no organism can function without proteins and that proteins are one of the reasons why bioorganisms exist. 18

Bioloogia → Bioloogia
18 allalaadimist
Valgud ja geenid
63
pdf

Valgud ja geenid

­ keskkonna tingimuste muutusel · Peamised tüübid (võtmed): ­ steroid retseptor ­ zinc finger valgud ­ leucine zipper (iga 7. on leu) Wendy Prioonid · Prions, which cause diseases such as Creutzfeldt-Jakob and BSE (Bovine spongiform encephalopathy, commonly called mad cow), are pretty scary stuff. They don't have any genetic material; instead, they're made from a protein that's normally produced by the brain. Like something out of science fiction, they adopt a distinct conformation, and then induce all the other proteins around them to adopt the same structure, gradually creating a tangle that's fatal to brain cells. Expose a healthy animal to the prions of a sick one, and the diseased form will gradually take over. · As if that weren't scary enough, evidence has been building that there are different strains of prions, presumably

Bioloogia → Bioloogia
4 allalaadimist
Sunflower
31
doc

Sunflower

commonly used oil. High oleic sunflower oil (over 80% oleic acid) was developed commercially in 1985 and has higher oxidated stability than conventional oil. It has expanded the application of sunflower oils for frying purposes, tends to enhance shelf life of snacks, and could be used as an ingredient of infant formulas requiring stability. B. Meal: Non-dehulled or partly dehulled sunflower meal has been substituted successfully for soybean meal in isonitrogenous (equal protein) diets for ruminant animals, as well as for swine and poultry feeding. Sunflower meal is higher in fiber, has a lower energy value and is lower in lysine but higher in methionine than soybean meal. Protein percentage of sunflower meal ranges from 28% for non-dehulled seeds to 42% for completely dehulled seeds. The color of the meal ranges from grey to black, depending upon extraction processes and degree of dehulling. C. Industrial Applications:

Ökoloogia → Ökoloogia ja keskkonnakaitse1
17 allalaadimist
Spikker molekulaarbioloogia teiseks kontrolltööks
2
doc

Spikker molekulaarbioloogia teiseks kontrolltööks

järjestuse kodeerimist nii mitu korda seejärel DNA Pol I asendab praimerid ja DNA ligaas ühendab fragmendid. Transkriptsioon- RNA tegemine DNAlt. Selles osalevad DNA, Tfid, RNA polümeraas ja ATP. Transkriptsiooniks on vaja DNA lõiku, mis koosneb osadest ( transkriptsiooni ühik ehk ala mida transkribeeritakse, sellest ülavoolu asub TATAbox ja enhanser). Edukaks transkriptsiooniks on vaja mõndasid TF´eid. Suurim TFIID sisaldades omakorda TBP (tata binding protein) mille kaudu kogu kompleks istub DNA transkriptsiooni initsiatsiooni saidile kasutadeski selleks TATAboxi. Seejärel lisanduvad teised TF, eeskätt TFIIB luues võimaluse POLII seondumiseks, mis omakorda aktiveeritakse TFIIF poolt- moodustub preinitsiatsiooni kompleks. Sellele seondub TFIIE luues võimaluse TFIIH seondumiseks.. TFIIH põimib kaksikahela lahti ja annab polümeraasile võimaluse mööda matriitsahelat liikuma hakata. Kui 5-10 bp kodeeritud hakkab TFIIH sünteesima Poly saba

Bioloogia → Molekulaar - ja rakubioloogia...
56 allalaadimist
A short overview of veganism
18
pptx

A short overview of veganism

qid=201307 02051443AA7amYA https://celestialhealing.net/physicalveg3.htm https://www.peta.org/living/food/meat-contamination/ http://www.naturallyhealthyskin.org/anatomy-of-the-skin/ the-dermis/sweat-glands-and-lymph-nodes/ Used https://www.vivahealth.org.uk/wheat-eaters-or-meat-eaters/ length-digestive-tract sources 3 Week Artery Clearing Dietary Trial: http://dresselstyn.com/JFP_06307_Arti... Vegan Protein Levels Are Higher Study: http://www.sciencedirect.com/science/article/pii/S00652 42309470070 12 Weeks Diabetics Gone Vegan Trial: https://www.ncbi.nlm.nih.gov/pubmed/10446033 Vegans 16% less cancer Study:

Keeled → Inglise keel
1 allalaadimist
Bioloogiaalsed sõnad
4
doc

Bioloogiaalsed sõnad

25. der Startcodon- startkoodon 26. der Stopcodon- stoppkoodon 27. der Klonierungsverktor, -en - kloneerimisvektor 28. der Transformation, -en - transformatsioon 29. die Sequenzierung, -en - sekveneerimine 30. die Synthese- süntees 31. die Labormethod, -en ­ laborimeetod 32. tierische Zelle- loomarakk 33. die Ribosomen- ribosoomid 34. die Morphologie, -n ­ morfoloogia 35. der Embryo- embrüo 36. die Mutagen, -e - mutageen 37. die Klonierung, - en - kloneerimine 38. das Protein- valk 39. abschalten- vigastama 40. die Genome, -en - genoom 41. die Infektionskrankheit, -en - infektsioonihaigus 42. die Hybridisierungsprobe, -en - hübriidproov 43. der Wirkstoff- e - toimeaine 44. die Bioinformatik- bioinformaatika 45. der Stoffwechsel,-e - ainevahetus 46. der Antibiotika, -en - antibiootika 47. der Struktur, -en - struktuur 48. der Wirkungsmechanismus, -en - toimemehhanism 49. der Peptid, -e - peptiid 50. die Mutasynthese,-en - mutasüntees 51. mikrobielle- mikroobiline

Keeled → Akadeemiline saksa keel
29 allalaadimist
Geenide regukatsioon
10
docx

Geenide regukatsioon

Oluline osa geenide regulatsioonis on enhaanseritel Enhaanseralade kasutamine (ja geenide aktivatsioon) sõltub rakus olevatest spetsiifilistest transkriptsioonifaktoritest Immuunrakkudel on retseptorite ja antikehade geenid, mis rekombineeritakse unikaalsel viisil Hamba arenguks on vaja paljude geenide koostöö Rakuvälised signaalid mõjutavad geenide ekspressiooni Eukaryotic cells have many different gene regulatory mechanisms A protein encoded from a gene may directly or indirectly affect its own gene activity (both positive or negative way) Transkriptsioonifaktori mitme seondumispiirkonna olemasolu geeni promootoris võimendab oluliselt transkriptsiooni taset Tuuma arhitektuur mõjutab geenide ekspressiooni

Bioloogia → Bioloogia
8 allalaadimist
Molekulaar- ja rakubioloogia KT I kordamisküsimused
8
docx

Molekulaar- ja rakubioloogia KT I kordamisküsimused

signaaljärjestusi. 2 tüüpi: (1) võivad olla järjestikused, (2) moodustada valgu eri osades selle pakkimise tulemusena. 15. Posttranslatoorsed modifikatsioonid. Atsetüleerimine (N--atsetüültransferaas); N-terminaalne metülatsioon; N-terminaalne müristoüleerimine; Lipiidide lisamine; C-terminaalne amidatsioon; glükosüleerimine, fosforüleerimine; GTP-d hüdrolüüsivad lülitid. Protein self-splicing ­ mehhanism, kus aktiivne valk saadakse pärast valgu autokatalüütilist modifitseerimist ­ lõigatakse välja osa järjestustest (intein) ja ligeeritakse ülejäänud valk kokku. II VALKUDE INTERAKTSIOONID 1. Ligand, sidumissait, afiinsus, dissotsatsioonikonstant. Ligand on valguga spetsiifiliselt interakteeruv molekul (polüpeptiid või mittevalguline)

Bioloogia → Molekulaar - ja rakubioloogia...
241 allalaadimist
Spordi toidulisandid
16
docx

Spordi toidulisandid

inimene saab endale sobiva toode üles leida ja osta kas poes või interneti teel ning lihtsalt üles leida õige kasutusjuhend ja palju muud kasulikku . Eesti populaarsem fitnessi veebileht on www.fitness.ee mida toetavad Eestimaa tuntud kulturistid Ott Kiivikas jt. Toidulisandid pole inimesele vajalikud, aga nad teevad treeningud kergemaks ja mugavamaks ning lihasmassi ning rekordite kasvu kiiremaks. SUMMARY There is not enough protein and other ingredients in our everyday life that we need. To get them, humans produced dietary supplements. Dietary supplements are mostly used in sports as an extra resource with food, to get better results or increase muscle mass. The most popular supplements are creatine and protein. Creatine is a substance which gives muscles energy. Protein is a substance, which helps muscles grow and recover. Vitamines are also necessary for human body, that can be used as dietary supplements

Kategooriata → Uurimistöö
57 allalaadimist
The Anaerobic Energy Systems 7
21
ppt

The Anaerobic Energy Systems 7

short duration and high intensity. ­ E.g. 100m sprint, 25m swim, smashing a tennis serve, lifting a weight upwards. · ATP-PCr can provide energy for 1 min of a brisk walk, a slow run for 20-30 seconds, and all-out sprinting for 6 to 8 seconds. Cont... · Quantity of high energy phosphates in muscle influences ability to generate all-out energy for brief durations · Longer duration performance, carbohydrates, fat, and protein provide necessary energy to recharge the pool of high energy phosphates · PCr reformation takes place only during recovery Task · Read through research article to answer the following: · What are the effects of different recovery duration of the levels of high energy phosphates? High-intensity Exercise Research · Bogdanis et al. (1995) 30 s sprint ­ PCr = 19.7 and ATP = 70.5% of the resting values, ­ muscle lactate was 11.9 mmol and muscle pH was

Keeled → Inglise keel
4 allalaadimist


Sellel veebilehel kasutatakse küpsiseid. Kasutamist jätkates nõustute küpsiste ja veebilehe üldtingimustega Nõustun