Tabeli-avaldised (CTE): DECLARE @fibLen AS INT = 10; WITH fibTable (rowNum, prevNum, fibNum) AS ( SELECT 1, 1, 1 UNION ALL SELECT rowNum+1, fibNum, prevNum + fibNum FROM fibTable WHERE rowNum < @fibLen ) SELECT fibNum FROM FibTable; GO Graaf-tabelid: SELECT DISTINCT Person.Name, Post.Content FROM Person, Posted, Post, Likes WHERE MATCH(Person-(Likes)->Post) SELECT Person1.Name, Post.Content, Comments.Comment, Person2.Name FROM Person Person1, Post, Posted, Comments, Person Person2 WHERE MATCH(Person1-(Posted)->Post<-(comments)-Person2) SELECT Person1.Name, Person2.name, Person3.name FROM Person Person1, Follows, Person Person2, Follows follows2, Person Person3 WHERE MATCH(Person1-(Follows)->Person2-(Follows2)->Person3)
monitor people's online activity? The government should find out about potential threats online but should still let people keep their privacy (e.g they shouldn't check people's emails who aren't suspected of anything) e.g People writing to each other about criminal activities People posting videos of shoplifting and not get caught etc Do I suport the idea that anonymous comments under online articles should be done away with? It depends where these comments are posted. For example I think that when it is posted to an online newspaper webpage it is not as bad as when people write to web pages like sayatme.com. Then it can really psychologically damage a person and even lead to a suicide. Do I think the latter would change the society for the better or the worse? I think it would make things better because most of the people don't have the courage to speak their mind when they have to take responsibility for their words. That means that people would
Peeter Orav Tallinn, Harjumaa Toome Kinnisvara OÜ Tartu mnt 120b Tallinn, Harjumaa Tartu mnt 999a 08 December 2020 Dear Sir Broker for your real estate company I am writing to apply for the top broker place which I saw posted in cvkeskus.ee. Last year, I worked as a car salesman in my brothers company. My responsibilities there were checking the cars, talking to clients and signing the papers. I also own a couple rental properties, which make me money passively. I consider myself to be trustworthy, enterprising and independent. If necessary I can supply references from the manager of the company. I would be grateful for the opportunity to visit your agency and discuss my application with you in person
It is possible but very unlikely, that the condition will be fulfilled. Form: if + Simple Past, Conditional I (= would + Infinitive) Example: If I found her address, I would send her an invitation. Conditional Sentence Type 3 It is impossible that the condition will be fulfilled because it refers to the past. Form: if + Past Perfect, Conditional II (= would + have + Past Participle) Example: If I had found her address, I would have sent her an invitation. · You've posted my letters, haven't you? · You won't forget to check my emails, will you? · You're sad that I'm going, aren't you? · You aren't going to cry when I leave, are you? · You play tennis on Thursdays usually, don't you? · And Jack plays with you, doesn't he? · You didn't play last Thursday, did you? · There's nothing wrong, is there? · There weren't any problems when you talked to Jack, were there?
GGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQAMKPGCTLFFLLCSALTVTTEAHAQTPDTA TTAPYLLAGAPTFDLSISQFREDFNSQNPSLPLNEFRAIDSSPDKANLTRAASKINENLYASTALERGTLKIKSI QMTWLPIQGPEQKAAKAKAQEYMAAVIRTLTPLMTKTQSQKKLQSLLTAGKNKRYYTETEGALRYVVADNGEKGL TFAVEPIKLALSESLEGLNKMTIQQWLFSFKGRIGRRDFWIWIGLWFAGMLVLFSLAGKNLLDIQTAAFCLVCLL WPTAAVTVKRLHDRGRSGAWAFLM VASTUS: Kasutasin programmi Protein-protein BLAST (blastp) Format alignments 500 Sarnased järjestused Database: NCBI Protein Reference Sequences Posted date: Apr 9, 2006 5:23 AM Number of letters in database: 811,773,583 Number of sequences in database: 2,250,671 Lambda K H 0.319 0.133 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2250671 Number of Hits to DB: 127332226 Number of extensions: 4937094 Number of successful extensions: 13884 Number of sequences better than 10: 117 Number of HSP's better than 10 without gapping: 0
JOB INTERVIEW How did you prepare for this interview? When I found this position posted on the internet I was immediately interested. I checked out the company website and mission statement, looked at the bios of company founders and executives, and was impressed. Once I had the interview appointment, I talked with friends and acquaintances in the industry. Why do you want this job? I've been very careful about the companies where I have applied. When I saw the ad for this position, I knew I found what I was looking for
Aktiiv Passiiv Present Tegusõna algvorm be + 3.v Simple Somebody cleans this room every day. This room is cleaned every day. Past Simple 2.v was/were + 3.v Somebody built this house in 1895. This house was built in 1895. Future Simple will/shall + 1.v will/shall + be + 3.v People will forget this soon. This will be forgotten soon. Present be + -ing be + being + 3.v Progressive Somebody is cleaning the room right now. The room is being cleaned right now. Past was/were + -ing was/were + being + 3.v Progressive Somebody was cleaning the room when I The room was being cleaned when I ...
Fifth level ,,Thigh Gap" trend The thigh gap trend began in December after the VS Fashion show and is very prominent on Tumblr, Instagram and pinterest. This trend can also be indetified as ,,thinsporation" or thinspo The ,,thinspo" hashtag, along with ,,proanorexia", ,,probelemia" have been shut down on Instagram and are completely unsearchible. However, pictures that contain these messages are still allowed to be posted. Worldwide effects Click to edit Master text styles Second level Photos like shown on the right have been Third level reblogged over 300,000 times. Fourth level
Little Muriel Parkinson liked the boy who was staying at her mother´s guesthouse. Leslie Ruggles was (1) C, which brought him to the Parkinsons´ house in Margate. During the summer they became close friends and were always together. Soon Leslie was well enough to return to his home in London. The two children were sad but (2) D . And sure enough, Muriel Parkinson reacived a Christmas card from Leslie. It arrived, however, (3) E, for it has just reached her. It was posted the Christmas after that happy summer they spent together. It dropped through the slot of the door where Muriel, 81, (4) G ago. Her illness had forced her to leave her home and move into an old people´s home. Now no one can clear up the mystery of the Christmas card (5) F to arrive. "I was suprised to see it after all these years," said Muriel. "I just kept looking at it. He had simply written With love from Leslie and nothing else."
In 1980, on the set of the film Caveman, he met actress Barbara Bach. They were married on 27 April 1981. Films · Aside from The Beatles films, Starr has acted in several films such as Candy, The Magic Christian, Blindman, Son of Dracula, Caveman etc. · His voice is also featured in Harry Nilsson's animated film The Point! 2000s · In October 2008, Starr posted a video on his website stating that he will not be signing autographs after 20 October 2008. He stated that he is too busy and that anything after that date sent to any address will not be signed. · On April 2009, Starr reunited with McCartney at Radio City Music Hall.
Topic Entertainment & Media The first newspapers were probably handwritten newssheets that government posted in public places. The earliest known newssheet was probably the Acta Diurna (Daily Events). Which began in Rome in 59 B.C. It reported the proceedings of the Roman Senate and such news as births and deaths.The first printed newspaper was a Chinese circular called Dibao. It was printed from carved wooden blocks during the A.D. 700's. The first regular published printed newspaper in Europe was Avisa Relation oder Zeitung of Strasbourg, Germany (now France). It started in 1609
So did newspapers, which were the first kind of mass media. A newspaper is a written publication containing news, information and advertising, usually printed on low-cost paper called newsprint. Newspapers often include articles on political events, crime, business, art, entertainment, society and sports. Most traditional newspapers also contain columns which express the personal opinions of the writers. The first newspapers were probably handwritten newssheets that governments posted in public places. There is a fundamental distinction between daily papers : quality and popular. Quality papers cater for more sophisticated readers. They contain detailed information and analyses of a wide range of issues. There is little use of colour, and a fairly discreet use of photographs and other illustrations, but they make great use of colour supplements, especially on Sundays when people have time to read more. (The Sunday Times is so big that it takes almost a whole
the world best heptathlon score of 2007. Klüft started the first day by equalling her Personal Best of 13.15 in the 100 m Hurdles and a new Personal Best of 1.95 in the High Jump. Solid performances of 14.81 in the shot put and 23.38 in the 200 m followed, for Klüft to hold the lead from Blonska after day one, with 4162 points. On the second day, Klüft recorded a long jump of 6.85, threw 47.98m in the javelin and ran 2:12.56 in the 800 metres to claim her third World Championship gold. She posted a personal best points score of 7,032, putting her second on the all time list, and beating Larisa Turchinskaya's 18 year old European record.
The first radio broadcasts were transmitted in the USA in 1916. Radio is generally the first of the news media to report a local story. Millions of people depend on the radio for regularly scheduled news bullets. Book-publishing grew rapidly in warily modern England and America. So did newspapers, which were the first kind of mass media. Newspaper is the oldest type of media. The first newspapers were probably handwritten newssheets that governments posted in public places. Although newspaper sales have fallen slightly over the past few years, they still have an important effect on public opinion. Newspapers often include articles on political events, crime, business, art, entertainment, society and sports. There is a difference between daily papers: quality papers cater for more sophisticated readers. They contain detailed information and analyses of wide range of issues. There is little use of colour. Popular papers are smaller,
source (or as much of that information as possible). The Web information is then placed at the end of the reference. It is important to use "Retrieved from" and the date because documents on the Web may change in content, move, or be removed from a site altogether. To cite a Web site in text (but not a specific document), it is sufficient to give the address (e.g., http://www.apa.org) there. No reference entry is needed. Here is an example of how to cite material posted on the APA's Web page. A similar format can be used to cite other sources, as long as the medium and the path are sufficiently identified. An article from the American Psychologist: Jacobson, J. W., Mulick, J. A., & Schwartz, A. A. (1995). A history of facilitated communication: Science, pseudoscience, and antiscience: Science working group on facilitated communication. American Psychologist, 50, 750-765. Retrieved January 25, 1996 from the World Wide Web: http://www.apa
s�ilimise eest ja on samas tasakaalustavaks j�uks kollase meedia skandaalseetele ja tihti alusetutele artiklitele. On selge, et majanduskriisi oludes muutub meedia tarbimine oluliseks ja inimestele tuleb pakkuda eelk�ige kainet anal��si ning v�hem paanikat. Kindlasti aitaks see inimestel praeguses olukorras paremini toime tulla. Hinne oli 4 Arutlus: Milliseid v�ljakutseid esitab inimesele �hiskonna muutumine posted Dec 8, 2008, 3:13 AM by Ago Press Inimkonna kujunemise algusaegadest saati on kehtinud mingisugune �hiskonna korraldus. Olgu selleks siis perekonnakeskne ja taludest moodustunud agraar�hiskond v�i masinate v�iduk�igu toonud industriaal�hiskond, inimesed on ju p�him�tteliselt samaks j��nud. Erinevad �hiskonna korraldused kehtestavad aga teatud n�udmisi. Muutused �hiskonnas on tingitud kindlast asjaolust. N�iteks t��stus�hiskonna
väiksem. Eestlaste suhtelise vaesuse määr oli 2013. aastal mitte-eestlaste omast 2 üheksa protsendipunkti madalam ja absoluutse vaesuse määr neli protsendipunkti madalam. Eestlastest elas suhtelises vaesuses 19,5% ja absoluutses vaesuses 6,8%, mitte-eestlaste samad näitajad olid 28,6% ja 11%. Suhtelises vaesuses elas 2013. aastal iga viies elanik Posted on jaanuar 29, 2015 Suurim on vanima vanuserühma ehk vähemalt 65-aastaste suhtelise vaesuse määr. 2013. aastal oli vähemalt 65-aastaste suhtelise vaesuse määr 31,8%. Keskmine vanaduspension on suhtelise vaesuse piirile lähedal ja seetõttu ei ole pensionäride vaesus sügav. Vanemaealiste sügava ehk absoluutse vaesuse määr oli 2,2%. Laste (017-aastased) suhtelise vaesuse määr oli 2013. aastal 20,2%. Lapsed elavad
Samsung Techwin is pushing ahead with an endless series of innovations to enable customers all around the world to enjoy an exciting photo culture through Samsung DSC. The innovations include developments related to optical and image processing techniques, unique Samsung designs intended to give customers ultimate satisfaction, and skills that will help customers to enjoy photography comfortably. 8 Over the past two years, Samsung Camera has posted rapid growth, rising to the position of the world's No.3 in terms of market share in 2007. In 2008, the Company will focus on premium marketing practices, enhancing its brand image and expanding its global sales network, with the aim of becoming the world's best camera brand by 2010. 4.3 Optics and Digital Imaging Samsung Techwin introduces onto the market an array of first-rate security equipment, including surveillance cameras, DVRs (digital video recorder) and network control
manuscripts on topics like science, art and life.During the Middle Ages people were guided by the church, which was against wealth, trading goods and other worldly interests. Humanists, however, did not believe that much in religion. They thought that money and trade were important in life and that citizens needed a good general education. During the Renaissance a churchman named Martin Luther changed Christianity. In 1517 he wrote a list of things that he didn't like about the church and posted them on the door of his church in Wittenberg, Germany. Luther also wanted the church to hold masses in German instead of Latin so that people could understand them better. Many other Christians agreed that the church was in need of change. Luther and others founded new religions and split away from the Roman Catholic church. Although changes took place everywhere in Europe, Florence was the centre of the Renaissance. Fifteenth century Florence was an exciting place to be
People of Kalamaja have organised summer beach parties and sauna parties there, with temporary sauna tents. In 2011, when Tallinn was a European Capital of Culture, the authors of Urban Intervention built changing cabins, benches and terraces to Kalarand. The beach area was cleared, the scrub trimmed and dustbins were provided for the summer season. The seabed of the bathing site was cleared of rubbish and pieces of concrete, water samples were taken and analysis results were posted on a notice board. (Lift11, 2011) All of this was made by initiative of locals. While the site was cleaner and more in order, Kalarand still remained as a non-public bathing beach and it was not included in the list of the Tallinn official beaches. Therefore there was no lifeguard present and swimming was strictly at own responsibility. It is clear that locals of Kalamaja value Kalarand and Kalasadam as a place where to spend their free time, to relax and recharge by the seaside
·Kuriteod
·Väärteod
·Tsiviilõigusrikkumised
·Distsiplinaarõigusrikkumised e tööõigusrikkumised
Juriidiline vastutus
·On riiklik sunnivahend, mis seisneb õigusrikkuja ja tema käitumise
hukkamõistmises õigusvastase süülise teo toimepanemise pärast ning
temale isikliku, organisatsioonilise või varalise iseloomuga kitsenduse
tekitamises.
Juriidilise vastutuse liigid
·Kriminaalvastutus
·Haldusvastutus
·Tsiviilõiguslik ehk varaline vastutus
·distsiplinaarvastutus
posted by Kristi Joamets @ 2:48 AM
0 Comments:
Post a Comment
<
Kant seeks to achieve this by advancing a hierarchical account of development of world history.In writing from the perspective of a universal future history, Kant valorizes an unrealized future state (though he is aware, however, of the problem of theorizing without empirical basis, recognizing the appearance of irrationality that such an enterprise exhibits and criticizing Herder for extracting conclusions from speculative pyschologizing). 9 thesises are posted to prove that rational and moral autonomy will defeat the compulsions of self-interested individualism. In a future state there will be a lot of freedom. I thesis Unnecessary parts of the society will naturaly dissapear. II thesis Man (one) can not learn to use hes reason. Society can. III thesis Nature has not made our society to grow more complex thanks to the previous generations, who have built our society. But nature gave us our minds, that we were able to use to work out this
Their original purpose was to give your faraway friends and relatives tidings of yourself and your immediate family. In other words, this custom existed for people to tell others whom they did not often meet that they were alive and well. Japanese people send these postcards so that they arrive on the 1st of January. The post office guarantees to deliver the greeting postcards by the first of January if they are posted within a time limit, from mid-December to near the end of the month and are marked with the word nengajo. To deliver these cards on time, the post office usually hires students part-time to help deliver the letters. It is customary not to send these postcards when one has had a death in the family during the year. In this case, a family member sends a simple postcard to inform friends and relatives they should not send New Year's cards, out of respect for the deceased.
It is important to note that especially in the early childhood years children's pictorial intentions may have little to do with creating a picture meeting the modernist standards of "child art". Their graphic activity is often just one component of a semiotic process in which sounds, gestures, and words carry a significant portion of meaning. In this context, a teacher's ability to accept these images as active happenings rather than as objects to be posted on a day care or primary classroom walls may help children to understand the value of this unique multimodal system of representation and see it as alternative to other pictorial efforts where, in conformity with the deep- rooted tradition of Western art, images are supposed to stand on their own. Similarly, understanding that telling of a dynamic story may require a child to use different pictorial devices than in the case of descriptive effort, a greater range of imagery can become socially
Bumble, came to collect Oliver and take him to the board for an interview. They told him he was to live with other wards of the state to become educated and learn a trade. Oliver did not mind this, but soon after he arrived, the state decided to implement a plan that would save money by feeding the people very little. After a time on this diet, the boys at the table chose Oliver to go ask the head cook for more gruel. Oliver did this, and was taken away. A flyer was then posted that said the state would give five pounds for someone to take young Oliver off their hands. Chapter3: The board locked up Oliver in what he called the `dark room' all day until someone would take him as an apprentice. After several days of solitary confinement, several beatings, and being made an example of at mealtime, Oliver thought he would do just about anything to leave the workhouse. However, when a chimneysweep, Mr. Gamfield, came to get the money offered and Oliver the boy
(only heterogeneities that were visible in more than one clone from (about 34 ng DNA for 1 gemmule, 240 ng to 500 ng for 5 a specimen are shown). Some of these sequences were specific to gemmules, vs ,10 000 ng for young sponges grown from about a one animal; others were represented in several animals. All thousand gemmules; for PCR amplifications ,1 ng, 8 ng and individual sequences obtained from clones are posted in NCBI 17 ng vs 100 ng of DNA was used, respectively), and therefore the GenBank (http://www.ncbi.nlm.nih.gov/) under accession num- accuracy of the results of corresponding PCR amplifications were bers KC243990KC244049. comparable to those where 1 ng or 10 ng of DNA extracted from The data obtained by sequencing individual clones suggested young sponges had been used.
commercial and noncommercial legal persons. An existence of an entrepreneurial entity is veri- fied by a record of the registry of commercial and noncommercial legal persons. The registration of the entrepreneurial entity covers both state and tax registration. A decision of the registering body on registration becomes effective upon its official presentation to the party or as soon as it gets published. The decision is considered published once it is posted at the webpage of the registering body. 4. The registration of an entrepreneurial entity is undertaken according to the address chosen by the entity. A written notification (correspondence) sent to this address is considered as an of- ficially dispatched notification (correspondence) (legal address). Article 5. Terms of Registration of an entrepreneurial entity 1. In case of requesting a registration of a company, an application for registration signed by
two conflicts demonstrated children`s increasing `political awareness in a world transformed by ongoing crises of war and conflict`57. In response to the Newsround query of `How has 11 September changed the world?` two young teenagers acknowledged: `It really made me realise how bad life is for some people and it’s made me pay more attention to what’s going on in the world. It was really, really terrible! (Susan, 13; posted 13 September 2002) It’s made me watch the news more and aware of what’s happening in the world. (Frankie, 13; posted 13 September 2002)`.58 On the contrary, while Newsround actively encourages children to develop the political knowledge and have their voices heard, then the credibility of children and young people in participating in the world of politics is greatly downplayed by the rest of the media. 59 Instead
Gutenberg" is associated) is accessed, displayed, performed, viewed, copied or distributed: This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenberg License included with this eBook or online at www.gutenberg.org 1.E.2. If an individual Project Gutenberg-tm electronic work is derived from the public domain (does not contain a notice indicating that it is posted with permission of the copyright holder), the work can be copied and distributed to anyone in the United States without paying any fees or charges. If you are redistributing or providing access to a work with the phrase "Project Gutenberg" associated with or appearing on the work, you must comply either with the requirements of paragraphs 1.E.1 through 1.E.7 or obtain permission for the use of the work and the Project Gutenberg-tm trademark as set forth in paragraphs 1.E.8 or 1.E.9. 1.E.3
on the morning of August 1, 1943, for their 1,200-mile flight, the 9th Air Force spread a short message to Allied forces in the Mediterranean area announcing that a large mission was airborne from Libya. This was necessary because only a few weeks before, in the invasion of Sicily, the U.S. Navy had shot down dozens of American troop planes in the tragically mistaken belief that they were German bombers. The message was picked up by a Funkaufklarungsdienst unit recently posted near Athens. Soon its cryptanalysts had reduced it to plaintext. Lieutenant Christian Ochsen-schlager then passed to all defense commands "interested or affected" a message stating that a large formation of four-engined bombers, believed to be Liberators, had been taking off since early morning in the Bengazi area. This gave the antiaircraft defenses at Ploesti, the heaviest in Europe, plenty of time to get ready. When the bombers roared at derrick-top height over the
The Public Eye One reason that written testaments are effective in bringing about genuine per- sonal change is that they can so easily be made public. The prisoner experience in Korea showed the Chinese to be quite aware of an important psychological princi- ple: Public commitments tend to be lasting commitments. The Chinese constantly arranged to have the pro-Communist statements of their captives seen by others. They were posted around camp, read by the author to a prisoner discussion group, or even read on the camp radio broadcast. As far as the Chinese were concerned, the more public the better. Why? Whenever one takes a stand that is visible to others, there arises a drive to maintain that stand in order to look like a consistent person (Tedeschi, Schlenker, &. Bonoma, 1971; Schlenker et aI., 1994). Remember that earlier in this chapter I de-
indeed genetically determined) to the homozygous recessive condition at some locus other than that of the albino series of the black-brown alternatives. [Modern notation for the offspring: Aa Bb Ccs Dd oo T- (I’ve used “T” on its own because the report doesn’t say if the tabby is classic (Tc) or mackerel ( TM )] Neil B. Todd The Biological Laboratories, Harvard University And that seemed to be the end of it until 2015 when Kathryn Eden posted photos of Milkdud, a Donskoy (Don Sphynx kitten) whose colour defied analysis. Born to black parents, Milkdud’s genetic test results were: Agouti Result: a/a - Non-agouti (solid colour) Albino Result: N/N - No copies of albino allele are present. Amber Result: E/E - No copies of the mutation for Amber. Brown Result: B/B - Full color black, does not carry brown or cinnamon.
white truffle sea salt. Here's another case study, this time from JayC: 10/18/20082/14/2009: Starting weight: 260 lbs, Today's weight: 212 lbs Wow! This is the first time I've been less than 215 since my freshman year of college! I hit a bit of a plateau after getting down to 220 on Christmas. I was eating the same, drinking the same, etc and stayed at 220! So how did I get over this plateau?? By eating more! Can you believe the awesomeness of this lifestyle? Tim had posted ... to eat at least 30g of protein upon waking, and to up the water even more so. Reluctantly I enlarged my breakfast and lunch portions and BAM! Skip breakfast, forget to eat within one hour of waking, and you will fail. MISTAKE #2: NOT EATING ENOUGH PROTEIN Get at least 20 grams of protein per meal. This is absolutely most critical at breakfast. Eating at least 40% of your breakfast calories as protein will decrease carb impulses and promote a negative fat balance. Even 20% protein--
c. o Presentthe surveyresults.Elicithow a surveyis 'publishing industry'intheprevioussentence conducted. (Arondomgroupof peopleareoskeda set 2 reference words:'soldmorecopies, in thenextsentence of questions. Theresults orecollectedand percentoges 3 referencewords: 'posted,and ,on the lnternet,in the arecalculoted,whicharethenrepresentedon o choi or previoussentence graph.)Readout the questionsand the example. Ss answer the questions.Check Ss, answers 4 reference words:'25hours'in the nextsentence and 'slow, in thesentencefollowing aroundthe class
c. o Presentthe surveyresults.Elicithow a surveyis 'publishing industry'intheprevioussentence conducted. (Arondomgroupof peopleareoskeda set 2 reference words:'soldmorecopies, in thenextsentence of questions. Theresults orecollectedand percentoges 3 referencewords: 'posted,and ,on the lnternet,in the arecalculoted,whicharethenrepresentedon o choi or previoussentence graph.)Readout the questionsand the example. Ss answer the questions.Check Ss, answers 4 reference words:'25hours'in the nextsentence and 'slow, in thesentencefollowing aroundthe class
c. o Presentthe surveyresults.Elicithow a surveyis 'publishing industry'intheprevioussentence conducted. (Arondomgroupof peopleareoskeda set 2 reference words:'soldmorecopies, in thenextsentence of questions. Theresults orecollectedand percentoges 3 referencewords: 'posted,and ,on the lnternet,in the arecalculoted,whicharethenrepresentedon o choi or previoussentence graph.)Readout the questionsand the example. Ss answer the questions.Check Ss, answers 4 reference words:'25hours'in the nextsentence and 'slow, in thesentencefollowing aroundthe class
c. o Presentthe surveyresults.Elicithow a surveyis 'publishing industry'intheprevioussentence conducted. (Arondomgroupof peopleareoskeda set 2 reference words:'soldmorecopies, in thenextsentence of questions. Theresults orecollectedand percentoges 3 referencewords: 'posted,and ,on the lnternet,in the arecalculoted,whicharethenrepresentedon o choi or previoussentence graph.)Readout the questionsand the example. Ss answer the questions.Check Ss, answers 4 reference words:'25hours'in the nextsentence and 'slow, in thesentencefollowing aroundthe class
In Proceedings 59th Reciprocal Meat Conference. Champaign-Urbana, meat packaging applications (Schut 2008). Illinois. The polymers are said to biodegrade when Brody, A. L. 1970. Shelf life of fresh meat. Modern packages that are made from them are com- Packaging 1:81. Buys, E. M. 2004. Colour changes and consumer accept- posted. Moisture and heat in the compost pile ability of bulk packaged pork retail cuts stored under break the PLA polymer chains to smaller O2, CO2 and N2. Meat Science 68:641–647. chains, and then ultimately to lactic acid. Callow, E. H. 1932. Gas storage of pork and bacon. Part 1.Preliminary experiments. Journal of the Society of Microorganisms in the compost consume Chemical Industry 51:116–119.
annaabi.ee 
