Vajad kellegagi rääkida?
Küsi julgelt abi LasteAbi
Logi sisse
Sulge

"phosphorus" - 27 õppematerjali

phosphorus - hääl läheb kähedaks, neeluosa tundub hell.
FOSFOR
22
pdf

FOSFOR

Mürgine on ainult valge fosfor, mis on üks tugevaimaid mürke, juba 0,1g on surmav. Meeles tuleb pidada, et ka hapnikuga reageerides eralduvad aurud on mürgised, mistõttu on katsed soovitatav sooritada tõmbekapis. Ka nahale sattudes põhjustab fosfor väga raskesti parandatavaid põletushaavu (vt. Joonis 5). (Toxnet, 2006) Joonis 5. Fosfori põletushaavad. (Boon, 2015) 9 Kasutatud materjalid Boon, N. Y. (5. märts 2015. a.). A Phosphorus Burn: ePlasty. Allikas: ePlasty: http://www.eplasty.com/index.php?option=com_content&view=article&id=1329&catid =49 Chemicum. (kuupäev puudub). Punase fosfori süttimine: Chemicum. Allikas: Chemicum: http://www.chemicum.com/?video=7&lan=EE Chemicum. (kuupäev puudub). Valge fosfori süttimine õhus: Chemicum. Allikas: Chemicum: http://www.chemicum.com/?video=7&lan=EE ENE peatoimetus. (1982). ENEKE. Tallinn: Valgus. Gagnon, S. (kuupäev puudub). The Element Phosphorus: Jefferson Lab

Keemia → Elementide keemia
14 allalaadimist
Keemilised elemendid
1
ods

Keemilised elemendid

Leht1 Vesinik H Hydrogenium Heelium He Helium Liitium Li Lithium Berüllium Be Beryllium Boor B Boron Süsinik C Carboneum Lämmastik N Nitrogenium Hapnik O Oxygenium Fluor F Fluorum Neoon Ne Neon Naatrium Na Natrium Magneesium Mg Magnesium Alumiinium Al Aluminium Räni Si Silicium Fosfor P Phosphorus Väävel S Sulphur Kloor Cl Chlorum Argoon Ar Argon Kaalium K Kalium Kaltsium Ca Calcium Raud Fe Ferrum Baarium Ba Barium Kroom Cr Chromium Magnaan Mn Manganese Vask Cu Cuprum Hõbe Ag Argentum Plii Pb Plumbum Nikkel Ni Nickel Kuld Au Aurum Lehekülg 1

Keemia → Keemia
11 allalaadimist
KEEMILISTE ELEMENTIDE NIMETUSED-TÄHISED-SÜMBOLID
2
docx

KEEMILISTE ELEMENTIDE NIMETUSED, TÄHISED (SÜMBOLID)

KEEMILISTE ELEMENTIDE NIMETUSED, TÄHISED (SÜMBOLID) MITTEMETALLID Keemiline element Keemilise elemendi Keemiline tähis Hääldatakse eesti keeles ladinakeelne nimetus keemilises valemis Fosfor Phosphorus P pee Hapnik Oxygenium O oo Heelium Helium He heelium Jood Iodum I ii Kloor Chlorum Cl kloor Lämmastik Nitrogenium N enn Räni Silicium Si siliitsium

Keemia → Keemia
12 allalaadimist
Veenus
10
pptx

Veenus

meenutavad suuresti tingimusi Maa pilvedes. Ehatäht ja koidutäht Et Veenus on Maalt vaadates alati Päikese lähedal, siis ta paistab kas õhtu- või hommikutaevas. Esialgu ei teatud, et tegu on sama taevakehaga. Veenust nimetati Eesti rahvaastronoomias vastavalt Ehatäheks ja Koidutäheks või Aotäheks, Vana-Kreekas vastavalt Hesperoseks (ladina Hesperus) ja Phosphoroseks (ladina Phosphorus). Saadud andmed Kõik andmed planeedi Veenuse kohta on leitud vikipeediast. http://et.wikipedia.org/wiki/Veenus

Füüsika → Füüsika
4 allalaadimist
Northern Europe’s seas-Norther Europe’s environment
2
pdf

"Northern Europe’s seas. Norther Europe’s environment"

marine environment. One of the main problems is the chemical pollution which is caused by natural or man- made halogenated compounds, pesticides, dioxins, chlorinated organic materieals and so on. These compounds are causing deformage in marine animals and are storaged in their fatty tissues. They have also been found in organisms throughout the world oceans because they are dispersed quickly by winds and currents. Another problem that affects the marine life is excess phosphorus and nitrogen flow into the sea from towns, factories and other man-made sources which cause intense algae growth. Algal blooming consumes large amounts of dissolved oxygen and in areas with poorer water exchange the oxygen runs out and living organisms will not survive there. Also, the author points out a problem considering heavy metals which increase the water toxicity. It is estimated that about half of heavy metal inputs to the North and Baltic Seas originate as air pollutants

Keeled → Erialaline inglise keel
2 allalaadimist
KEEMILISED ELEMENDID
1
doc

KEEMILISED ELEMENDID

Heelium He VIIIA 1. - Avastati 1868.aasta päiksevarjutuse ajal Germaanium Gr IVA 4. - Germaaniumi avastas saksa teadlane Clemens Alexander Winkler. Kaltsium Ca IIA 4. Calcium Puhast kaltsiumi sai esmakordselt elektrolüüsil 1855.a Robert Bunsen Fosfor P VA 3. Phosphorus Fosfori avastas Saksa alkeemik Hennig Brand 1669 Hamburgis Tseesium Cs IA 6. - Esimest korda avastasid tseesiumi Gustav Robert Kirchhoff ja Robert Wilhelm Bunsen 1861. aastal Poloonium Pl VIA 6. - Polooniumi avastasid 1898. aastal

Keemia → Üldkeemia
17 allalaadimist
Forfor
12
odp

Forfor

Fosfor Fosfor (phosphorus) (phosphorus) Laura LauraToodu Toodu Birgit Ritsbek Birgit Ritsbek Merilin MerilinJegers Jegers Karen Vapper Karen Vapper 10.b 10.bklass klass Fosfor P mittemetall Aatomnumber: 15 Aatommass: 30,97376 Klassifikatsioon: penteelid, p-elemendid Aatomi ehitus: · Elektronvalem: 1s2 2s2p6 3s2p3 · Elektronskeem: +15|2)8)5) · Elektronite arv: 15 · Neutronite arv: 16 · Prootonite arv: 15 · Oksüdatsiooniast(m)e(d) ühendites: -III, -II...0...II, III...V · Kristalli struktuur: monokliinne Fosfor võib e sine da mit m it me s vor mis. Va lge fosfor on tahke krist a lne a ine . Kee milise lt puhta d va l...

Keemia → Keemia
6 allalaadimist
Tundra
2
pdf

Tundra

the coniferous forests of the taiga. The ecotone (ecological boundary region) between the tundra and the forest is known as the tree line or timberline. Tundra comes from the Finnish word tunturi, meaning treeless plain. It is noted for its frost-moulded landscapes, extremely low temperatures, little precipitation, poor nutrients, and short growing seasons. Dead organic material functions as a nutrient pool. The two major nutrients are nitrogen and phosphorus. Nitrogen is created by biological fixation, and phosphorus is created by precipitation. The most distinctive characteristic of tundra soil is its permafrost, a permanently frozen layer of ground. The average winter temperature is -28°C, but the average summer temperature is 3-16°C. During the brief summers, the top section of the soil may thaw out allowing plants and microorganisms to grow and reproduce. However, these plants and microorganisms become dormant during the cold winter months

Geograafia → Inglisekeelne geograafia
5 allalaadimist
Lämmastik ja fosfor
23
ppt

Lämmastik ja fosfor

omadused väga inertne aktiivne mittemetall Vastavad HNO3- HPO3- happed lämmastikhape metafosforhape HNO2 - H3PO4- lämmastikushape fosforhape Kasutatud kirjandus http://et.wikipedia.org/wiki/L%C3%A4mmastik http://www.miksike.ee/documents/main/lisa/8klass http://en.wikipedia.org/wiki/Nitrogen http://et.wikipedia.org/wiki/Fosfor http://en.wikipedia.org/wiki/Phosphorus Üldine ja anorgaaniline keemia, X klassi õpik Tänan vaatamast !

Keemia → Keemia
40 allalaadimist
Recreational use of Pärnu river-essee
2
doc

Recreational use of Pärnu river (essee)

altitude - 78 m, mean flow 64,4 m3/s and precipitation 700 mm. Main problems are floods, agricultural pollution, pollution from the local communities, drainage system and flood plain grasslands. There is an excessive flooding in spring. The most known is the Soomaa swamplands flooding in april. It is called to be the fifth season. A lot of rich soil are situated near the pärnu river, for example some of the biggest farmlands are situated in the Järva county. 83% of phosphorus and 79% of nitrogen originates from human activities of the total discharge of biogenes from Pärnu River basin. The soil does not bind a huge amount of the nutrients. 65 % of the treatment plants are over 15 years of age and most of them are programmed in a way, that when the water level exceeds some point, the sewage water will be sent directly to the outflow or in some cases to some biopools. There are a lot of straight drainage systems, ditches and dykes near the forests and

Maateadus → Hüdroloogia
17 allalaadimist
Phosphate Binders-Your Questions Answered
2
docx

Phosphate Binders: Your Questions Answered

treatments helps remove just a little of the excess phosphate from your body. Thus, dialysis alone is not enough to control phosphate levels in your body. Diet and medications are also necessary. What else can I do to get the most out of my treatment? Here are several tips that will help you achieve the best outcome with phosphate binders. First, always take your medicine on time and everyday as prescribed. Second, you should receive regular lab testing to monitor your calcium, phosphorus and PTH levels. Finally, if you have problems with your medicines or are unsure if you are taking the medicine correctly, talk to your pharmacist for tips and advice. Ajit Kamdar, PharmD, is a graduate of Midwestern University College of Pharmacy - Glendale and currently works as a pharmacist at Express Scripts. Steven Morrison, PharmD, is a graduate of Midwestern University College of Pharmacy - Glendale and currently works for Walgreens Pharmacy in Glendale, AZ.

Keeled → Inglise keel
2 allalaadimist
Haritava maa kvaliteet
18
pdf

Haritava maa kvaliteet

is possible to foster competitive agricultural production. The share of low fertility, droughtly and coarse rich soils as well as eroded soils, nutrient - poor acid soils and overmoistened soils in the arable area, where agricultural production is not profitable, is relatively large. On all arable land soils with a low or very low content of lactate soluble potassium account for 40 - 65 %. Considerable phosphorus deficit occurs in 20 - 35 % of soils in the arable area. The soils of Põlva, Valga and Võru counties are exceedingly poor in humus. The available water supply in the metric profile of arable soils at the beginning of vegetation period varies from 140 to 255 mm. Gleyic and gley soils occupy the large areas in the West-Estonian depression, in the Peipus Lowland and Hiiumaa. In cental Estonia soil conditions are relatively favourable for agricultural production

Põllumajandus → Põllumajandus
5 allalaadimist
Tervis ja Heaolu - UNI ja PUHKUS
16
docx

Tervis ja Heaolu - UNI ja PUHKUS

muserdustest  Arsenicum- närvitsev, kärsitu, rahutu inimene  Argentum nitrosum- inimene, kes pelgab lähenevaid sündmusi: intervjuud, presentatsioonid või avalik esinemine  Coffea-(kohvioa nõrk lahjendus)- inimesele, kellel on kiire rabelev mõttetegevus, jalgade rahutus või eriline müratundlikkus  Ignatia- murelikule, nutusele või stressis olevale inimesele  Nux Vomica- ärrituvale ja vaimselt aktiivsele tüübile  Phosphorus- tundlikule inimesele, kes kaldub kannatama painajate all2 2Uni. Tänapäeva terviseraamat. Brence O`Hanlon.lk 96. kirjastus(Tänapäev) UNI ja TERVIS Uni ja tervis käivad alati käsikäes, täpselt nagu uni ja heaolu. Kui inimene on korralikult ennast välja maganud, eksisteerib ka inimesel hea tervis. Mis on nii oluline inimese heaolu kui tervise kohapealt. Unetus ehk insomnia on inimesele üks halvemaid tervisehädasid, millest ühaenam ja enam

Meditsiin → Terviseõpetus
11 allalaadimist
Maakera koostis
26
ppt

Maakera koostis

Teadlaste arvates on Eesti põlevkivi ehk kukersiidi tekkimisel olnud lähteaineks sinivetikad (tsüanobakterid). Huumus Humiinained Huumus Nonliving, finely divided organic matter in soil, derived from microbial decomposition of plant and animal substances. Humus, which ranges in colour from brown to black, consists of about 60 percent carbon, 6 percent nitrogen, and smaller amounts of phosphorus and sulfur. As humus decomposes, its components are changed into forms usable by plants. Humus is classified into mor, mull, or moder formations according to the degree of its incorporation into the mineral soil, the types of organisms involved in its decomposition, and the vegetation from which it is derived. Humiinhape Keemiline valem Humiinhape Humic acid has the average chemical formula C187H186O89N9S1 and is

Geograafia → Geograafia
14 allalaadimist
Maa-tüüpi planeedid
32
odp

Maa-tüüpi planeedid

päikeseööpäev 117 Maa ööpäeva. Seega on Veenuse aastas 2 ööpäeva. Ehatäht ja Koidutäht Et Veenus on Maalt vaadates alati Päikese lähedal, siis ta paistab kas õhtu- või hommikutaevas. Esialgu ei teatud, et tegu on sama taevakehaga. Veenust nimetati eesti rahvaastronoomias vastavalt Ehatäheks ja Koidutäheks või Aotäheks, Vana-Kreekas vastavalt Hesperoseks (ladina Hesperus) ja Phosphoroseks (ladina Phosphorus). Veenusest video : http://www.youtube.com/watch?v=Hg_NzWbsvxE Marss Marss on Päikesesüsteemi neljas planeet. Marss asub Päikesest 1½ korda kaugemal kui Maa ja saab seepärast poole vähem soojust.Teleskoobiga on see Maast poole väiksem punakas planeet hästi vaadeldav iga 15­17 aasta tagant suure vastasseisu ajal, kui Marsi ja Maa vaheline kaugus on ainult 55­60 mln km. Sel ajal paistab Marss taevas niisama heledalt kui Veenus.

Füüsika → Füüsika
4 allalaadimist
Keemia referaat fosforist
14
doc

Keemia referaat fosforist

Tartu Kivilinna Gümnaasium REFERAAT Fosfor (Phosphorus) Tartu 2009 Sisukord Sisukord .................................................................................................................. 2 Sissejuhatus ......................................................................................................... 3 Avastamine ............................................................................................................. 4 Füüsikalised omadused ..................................................................

Keemia → Keemia
46 allalaadimist
Veenus
15
odt

Veenus

Veenusel ei ole looduslikke kaaslasi, vaid ainult tehiskaaslased. Ehatäht ja Koidutäht Et Veenus on Maalt vaadates alati Päikese lähedal, siis ta paistab kas õhtu- või hommikutaevas. Esialgu ei teatud, et tegu on sama taevakehaga. Veenust nimetati eesti rahvaastronoomias vastavalt Ehatäheks ja Koidutäheks või Aotäheks, Vana-Kreekas vastavalt Hesperoseks (ladina Hesperus) ja Phosphoroseks (ladina Phosphorus). 11 Elu Veenusel USA teadlased jõudsid ajakirjas "Astrobiology" avaldatud artiklis järeldusele, et Veenusel võib leiduda elu. Mikroobid võivad elada ja paljuneda Veenuse õhukeses pilvekihis, mida kaitsevad päikesekiirguse eest selles leiduvad väävliühendid. Mõni aasta tagasi avastati meie planeedil bakter, mis on võimeline elama ja paljunema pilvedes

Füüsika → Füüsika
3 allalaadimist
Haigused
11
doc

Haigused

Võib ka oksendada. Pikali asi hullemaks. Tüüpiline astmaatiline köha. Rinnas palju lima, ei suuda välja köhida. (Drosera - kuiv, ibec.- lopsakas). Kalium carbonicum - ei ole mitte kunagi mitte millegagi rahul. Köhides terav, pistev valu rinnus. Kõige hullem kella kolme ajal öösel. Köhahoog läheb paremaks kui kallutab keha ettepoole. Sissehingamine vinguv. Soojas ja päevapoole paremaks. Dulcamara - köha kuiv, hommikul lahtisem, seotud ilmastiku muutusega. Phosphorus - hääl läheb kähedaks, neeluosa tundub hell. Tunne nagu kurgu peal oleks väike sügelus. Rääkimisega köhahoog. Asi hullemaks toast õue minnes. Köhides tuleb seest nagu magusat õhu maitset Rinnas pisted ja survetunne. Pulsatilla - kuiv köha õhtul ja öösel, hommikul läheb lahtisemaks. Siis tuleb ka palju lima. Sageli kollast röga. Tahab värsket, jahedat õhku. Jahe, värske õhk teeb paremaks. Spongia - hingamisteed kuivad, hääl kähe, neeluosa kibe. Kuiv haukuv köha

Meditsiin → Meditsiiniteadus
27 allalaadimist
Soil microflora
10
docx

Soil microflora

nutrients, pH, and many other factors which may vary between locations but also within a single plot and over very small distances (OECD, 2007). Nevertheless of the quantity of microflora, biomass of all microorganisms living in soil play an important role in the functioning of entire soil ecosystems because their enormous biochemical activity (Barabasz et al. 2002). Soil microflora cycles carbon, nitrogen, phosphorus, and sulfur, plays a role in soil structure formation, decomposition of organic matter, toxin removal, promoting plant growth, and in changes in vegetation (Canbolat at al. 2005 and Martin et al. 2012). Therefore, soil microflora plays a major role in preservation and the balance of life. Because of active role of soil micro- population, the diminution in microbial activity is always alarming (Barabasz et al. 2002). Factors influencing soil microflora

Keeled → Inglise keel
6 allalaadimist
ENVIRONMENTAL PROBLEMS
12
pdf

ENVIRONMENTAL PROBLEMS

the scarred female had come with them. Mated the previous May, she had returned to give birth to her calf in the south-eastern corner of the park. The soils which carpeted the floor of the shortgrass plains had been laid down in prehistoric times and were quite different from the black cotton clays of the Mara. (C) Eruptions of ash spewed out by the long-dead volcanoes of Ngorongoro had enriched the earth with calcium and phosphorus, minerals essential for healthy bone growth in the new-born calves, and if anywhere could be described as the true home of the restless wildebeest, it was here on these ancestral calving grounds. For nearly two decades the Serengeti wildebeest had been enjoying an (D) unprecedented population explosion. Twenty years ago, there had been perhaps 250,000. Now there were nearly two million, and together with a million gazelles and quarter of a million zebra, they formed the

Keeled → Akadeemiline inglise keel
31 allalaadimist
Geenitehnoloogia vastused
22
docx

Geenitehnoloogia vastused

and RNA splicing, which occur in the cell nucleus before the RNA is translated.[2] [edit]5' Processing Main article: 5' cap [edit]Capping Capping of the pre-mRNA involves the addition of 7-methylguanosine (m7G) to the 5' end. To achieve this, the terminal 5' phosphate requires removal, which is done with the aid of aphosphatase enzyme. The enzyme guanosyl transferase then catalyses the reaction, which produces the diphosphate 5' end. The diphosphate 5' prime end then attacks the gamma phosphorus atom of a GTP molecule in order to add the guanine residue in a 5'5' triphosphate link. The enzyme (guanine- N7-)-methyltransferase ("cap MTase") transfers a methyl group from S-adenosyl methionine to the guanine ring.[3] This type of cap, with just the (m7G) in position is called a cap 0 structure. The ribose of the adjacent nucleotidemay also be methylated to give a cap 1. Methylation of nucleotides downstream of the RNA molecule produce cap 2, cap 3 structures and so on. In

Keemia → Keemia
5 allalaadimist
MITTEMETALLID
16
doc

MITTEMETALLID

Esimesed kolm elementi (O, S, Se) on mittemetallid, Te on poolmetall ja Po on metall. Kalkogeenide vesinikuühendi valem on H2E. Seejuures muutub vesinikuühendi iseloom rühmas korrapäraselt. H2O on neutraalne aine, H2S, H2Se, H2Te ja H2Po on happelised, kusjuures happelisus kasvab H2OH2Po suunas. Kalkogeenid (välja arvatud O) moodustavad kaks oksiidi EO2 ja EO3, mis mõlemad on happelised, ning neile vastavad happed H2EO3 ja H2EO4. FOSFOR---PHOSPHORUS---P 1s22s22p63s23p3 1. Leidumine looduses ja saamine. Fosforit leidub looduses ainult ühenditena fosforiitide ja apatiide näol. Nende peamiseks koostisosaks on kaltsiumfosfaat Ca3(PO4)2. Fosforit saadakse fosforiidi või apatiidi, liiva ja söe segu kuumutamisel elektriahjus: 2Ca3(PO4)2+3SiO2+10C=3Ca2SiO4+P4+10CO 2. Fosfori allotroopia. Tähtsamateks fosfori allotroopseteks teisenditeks on valge, must ja punane fosfor

Keemia → Keemia
154 allalaadimist
Geenitehnoloogia vastused
27
docx

Geenitehnoloogia vastused

and RNA splicing, which occur in the cell nucleus before the RNA is translated.[2] [edit]5' Processing Main article: 5' cap [edit]Capping Capping of the pre-mRNA involves the addition of 7-methylguanosine (m7G) to the 5' end. To achieve this, the terminal 5' phosphate requires removal, which is done with the aid of aphosphatase enzyme. The enzyme guanosyl transferase then catalyses the reaction, which produces the diphosphate 5' end. The diphosphate 5' prime end then attacks the gamma phosphorus atom of a GTP molecule in order to add the guanine residue in a 5'5' triphosphate link. The enzyme (guanine- N7-)-methyltransferase ("cap MTase") transfers a methyl group from S-adenosyl methionine to the guanine ring.[3] This type of cap, with just the (m7G) in position is called a cap 0 structure. The ribose of the adjacent nucleotidemay also be methylated to give a cap 1. Methylation of nucleotides downstream of the RNA molecule produce cap 2, cap 3 structures and so on. In

Bioloogia → Geenitehnoloogia
105 allalaadimist
Sunflower
31
doc

Sunflower

Dwarf forms of 24 inches in height make a spectacular bed by themselves. When growing sunflowers for bird food or human consumption, select the confectionery types over the oil types Culture Sunflowers do best when grown on soils with adequate water-holding capacity, internal drainage and proper fertility. They will tolerate a wide range of soil types; however, one that is too high in nitrogen encourages excessive plant growth that will check maturity of the flower heads. Adequate levels of phosphorus and potassium are recommended, and, as with any garden activity, frequent soil tests are recommended to get good results. The plant's roots go deep and spread extensively, so the sunflower can withstand some drought and nearby cultivation. Sunflowers should not be water stressed during the critical period; about 20 days before and after flowering. Plant seed into moistened soil one to two inches deep, but no deeper than three inches.

Ökoloogia → Ökoloogia ja keskkonnakaitse1
17 allalaadimist
BIOinformaatika kodutöö 5
79
doc

BIOinformaatika kodutöö 5

QLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTN GETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQ NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHAC TQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTF SYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVS NHAY Püruvaatkinaas: EC 2.7.1.40 Class Transferases Transferring phosphorus-containing groups Phosphotransferases with an alcohol group as acceptor Escherichia coli K12 MG1655: >eco:b1676 pykF; pyruvate kinase [EC:2.7.1.40]; K00873 pyruvate kinase (A) MKKTKIVCTIGPKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKT AAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAVTYEGFTTDLSVG NTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGVNLPGVSIALPALAEKDKQDLIF GCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGI

Informaatika → Bioinformaatika
46 allalaadimist
ELEMENTIDE RÜHMITAMISE PÕHIMÕTTED
304
doc

ELEMENTIDE RÜHMITAMISE PÕHIMÕTTED

(NH3 atmosfääris, 500–600ºC):  suurendab metallipinna kõvadust  vähendab korrosiooni 3.14.4. Kokkuvõte Looduses levinud elutähtis element  valkude komponent  üks kolmest taimede põhi- toiteelemendist Anorg. lämmastikuühendid  väga mitmekesised, toodetakse suurtes kogustes Mõned loodusl. ühendid on tervisele kahjulikud (nitritid) või kantserogeensed (nitroosoühendid) 3.15. Fosfor P – Phosphorus (lad.) phōs – valgus, phóros – kandja avastas Hennig Brand (Hamburgi kaupmees) 1669 – Euroopas araabia alkeemik Alhid Behil (XII saj.) (avastam. ajaloost vt. Karik, H. Hämmastavad ained. Tln., 1991, lk. 120–126) 3.15.1. Leidumine looduses, biofunktsioon Maakoores 0,105 massi-%; levikult 13. kohal üks stab. isotoop 31P tuntud u. 200 fosforimineraali (kõik on fosfaadid) neist tähtsaim apatiit Ca5[PO4]3X (X on F või Cl), osal. anorg

Keemia → Keemia
77 allalaadimist
GETTING TO KNOW THE TOEFL
368
pdf

GETTING TO KNOW THE TOEFL

(B) accumulation (C) deletion (D) production 10. In contrast to traditional rhetoric, modern rhetoric has shifted its focus to the audience or reader. (A) intensified (B) narrowed (C) maintained (D) altered 11. The enormous rigid plates that make up the outer shell of the Earth continually move relative to one another. (A) vast (B) ancient (C) dense (D) deep 12. The process of eutrophication involves a sharp increase in the concentration of phosphorus and nitrogen and promotes the growth of algae. (A) conceals (B) boosts (C) disrupts (D) halts 13. Evidence that harmful effects may result from small amounts of radiation has prompted concern about low level irradiation from various sources. (A) minimized (B) exaggerate (C) generated (D) sustained 14. Large sponges often harbor smaller organisms. (A) shelter (B) reject (C) avoid (D) consume 15

Keeled → Inglise keel
13 allalaadimist


Sellel veebilehel kasutatakse küpsiseid. Kasutamist jätkates nõustute küpsiste ja veebilehe üldtingimustega Nõustun