Plaanid puhkusele minna? Võta endale majutus AirBnb kaudu ja saad 37€ kontoraha Tee konto Sulge
Facebook Like

Otsingule "alaelaalqllprlneglvitqgfigsenkgrtttlgrggsdytaallaealhasrvdiw" leiti 1 fail

23
doc

Järjestuste võrdlemine, otsingud andmebaasidest (BLAST, FASTA, SW).

2 bits (178), Expect = 4e-11 Identities = 3838 (100%), Positives = 3838 (100%), Gaps = 038 (0%) Frame = -3 Query 115 SEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLS 2 SEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLS Sbjct 1 SEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLS 38...

Bioinformaatika - Tallinna Tehnikaülikool
33 allalaadimist


Logi sisse ja saadame uutele kasutajatele
faili e-mailile TASUTA

Faili allalaadimiseks, pead sisse logima

Kasutajanimi / Email
Parool

Unustasid parooli?

UUTELE LIITUJATELE KONTO MOBIILIGA AKTIVEERIMISEL +50 PUNKTI !
Pole kasutajat?

Tee tasuta konto

Sellel veebilehel kasutatakse küpsiseid. Kasutamist jätkates nõustute küpsiste ja veebilehe üldtingimustega Nõustun