Plaanid puhkusele minna? Võta endale majutus AirBnb kaudu ja saad 37€ kontoraha Tee konto Sulge
Facebook Like

Otsingule "alaelaalqllprlneglvitqgfigsenkgrtttlgrggsdytaallaealhasrv" leiti 1 fail

23
doc

Järjestuste võrdlemine, otsingud andmebaasidest (BLAST, FASTA, SW).

NVIREEIERLLENITVLAE Sbjct 40 SAGITNLLVALAEGLEPGERFEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAE 99 Query 1159 aaalatspalTDELVSHGELMSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDIa 980 AAALATSPALTDELVSHGELMSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDIA Sbjct 100 AAALATSPALTDELVSHGELMSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDIA 159 Query 979 alaelaalqlLPRLNEGLVITQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRV -VW 803 ALAELAALQLLPRLNEGLVITQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRV +W Sbjct 160 ALAELAALQLLPRLNEGLVITQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIW 219 Query 802 SNPP 791 ++ P Sbjct 220 TDVP 223 Score = 73.2 bits (178), Expect = 4e-11 Identities = 3838 (100%), Positives = 3838 (100%), Gaps = 038 (0%) Frame = -3 Query 115 SEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLS 2...

Bioinformaatika - Tallinna Tehnikaülikool
33 allalaadimist


Faili allalaadimiseks, pead sisse logima

Kasutajanimi / Email
Parool

Unustasid parooli?

UUTELE LIITUJATELE KONTO MOBIILIGA AKTIVEERIMISEL +50 PUNKTI !
Pole kasutajat?

Tee tasuta konto

Sellel veebilehel kasutatakse küpsiseid. Kasutamist jätkates nõustute küpsiste ja veebilehe üldtingimustega Nõustun