> 33% (of norm) allows normal digestive function / < 6% [A very low] does not. max 3 [3] 6. (a) (i) award both marks for correct answer 10 000 / 800 000 (× 100); 1.25 / 1.3 / 1(%); 2 (ii) R any reference to energy / light missing the plant reflected (off plant) / only certain wavelengths of light can be, absorbed / used; ora absorbed by / hits, non-photosynthetic parts; e.g. bark passes through leaf / misses chlorophyll / misses chloroplasts; some is heat that is used in evaporation / respiration; max 2
response being observed). fMRI scans the oxygen concentration of blood in the brain (active brain tissue uses more oxygen) thus providing a vivid picture of brain activity without the need to inject patients with radioactive substance. Although researcher can now, quite literally, watch real-time presentations as brain regions light up when participants perform various tasks the temporal resolution is still poor (45sec fMRI / 60sec PET) and using these technologies is very expensive. With reference to relevant research studies, to what extent does genetic inheritance influence behavior? Psychologists argue that an individual may have a genetic predisposition towards a certain behavior; however, without the appropriate environmental stimuli, this behavior will not be manifested. There is no single cause-and-effect relationship between genes and behavior. It is not provable that a single gene is responsible for such complex behaviors as intelligence, criminal behavior or attachment
Kasutatud allikad 1. The World Factbook- https://www.cia.gov/cia/publications/factbook/print/dr.html 2. AXIS Geograafia Entsüklopeedia Loodus- ja inimgeograafia Ameerika lk 106- 107. 3. Human Development Reports- http://hdr.undp.org/hdr2006/statistics/countries/country_fact_sheets/cty_fs_DOM.html 4. IDB Population Pyramids- http://www.census.gov/cgi-bin/ipc/idbsum.pl?cty=DR 5. Dominican Republic City population- http://www.citypopulation.de/DomRep.html 6. Population Reference Bureau- http://www.prb.org/TemplateTop.cfm? Section=PRB_Country_Profiles&template=/customsource/countryprofile/countryprofiledis play.cfm&Country=359 7. World Urbanization Prospects- http://esa.un.org/unup/p2k0data.asp 8. Wikipedia- http://en.wikipedia.org/wiki/Santo_Domingo 9. Globalis- http://globalis.gvu.unu.edu/indicator.cfm?IndicatorID=46&country=DO#rowDO 10. Food and Agriculture Organization- http://faostat.fao.org/site/367/Default.aspx 11. Food and Agriculture Organization- http://www
Itaalia Vabariik Referaat Erik Salm Paide Ühisgümnaasium 2007 Itaalia Vabariik ISO 2-täheline kood: IT ISO 3-täheline kood: ITA Lipp: Vapp: Kaart: Geograafiline asend Itaalia Vabariik on riik Lõuna-Euroopas. Itaalia asub 800 km Vahemerre ulatuval saapakujulisel Apenniini poolsaarel. Põhjapoolne piirkond on mägine. Loodusliku piiri moodustavad Alpid. Maastik on suurte mägede ja sügavate orgude rohke. Itaaliale kuuluvad kaks Vahemere suurimat saart Sitsiilia ja Sardiinia - ning hulk väiksemaid saari. Põhjas on Itaalial maismaapiir Austria (430 km), Prantsusmaa (488 km), Sloveenia (232 km) ja Sveitsiga (740 km). Rannajoone pikkus on 7600 km. Enklaavina asuvad Itaalia territooriumil iseseisvad San Marino ja Vatikani riigid. Satelliitfoto Itaaliast Faktid: Pealinn: ...
negative than the value of a resting potential. HYPOTHALAMUS – A complex brain structure which consists of many nuclei and performs various functions. It regulates the activity of internal organs, monitors autonomic system and controls the pituitary gland. IMMUNE SYSTEM – Various tissues, cells and their products responsible for protecting the organism against harmful bacteria, viruses and parasites. INHIBITION – In general: reducing, blocking enzyme/receptor activity. In reference to the neurone, it is a synaptic event which stops the receiving neurone from firing. IONS – Electrically charged atoms or molecules. LIMBIC SYSTEM – A group of brain structures, which includes the amygdala*, hippocampus* and septum and help regulate emotions and memory. MEMORY CONSOLIDATION – The physical and psychological process which take place as the brain organizes and restructures information in order to make it a permanent element of memory
TALLINNA TEHNIKAÜLIKOOL Majandusteaduskond Avaliku sektori majanduse instituut Majanduspoliitika õppetool NOORTE TÖÖPUUDUS Kodutöö õppeaines majanduspoliitika Tallinn 2010 SISUKORD SISSEJUHATUS ........................................................................................................... 3 1. ÜLEVAADE NOORTE TÖÖPUUDUSEST ............................................................ 4 1.2 Noorte tööpuudus Euroopas ............................................................................................ 4 1.2 Noorte tööpuudus Eestis .................................................................................................. 7 2. TÖÖPOLIITIKA TÖÖPUUDUSE VÄHENDAMISEKS ...................................... 11 2.2 Noortele suunatud tööpuuduse leevendamise meetmed Eestis ..................................... 13 KOKKUVÕTE .....................................................
Reklaam on mitteisiklik infoedastusmeetod, mille eest tuleb kanda kulusid ja see on üldjuhul veenva iseloomuha ja sisaldab teavet toote teenuse kohta ning edastatakse mingis meediakanalis. On levitaja kasumile orienteeritud infoedastus, mis sisaldab probleemi ja selle lahendust. Reklaamobjektid: subjektid, äriobjektid, isikud/ühendused, tegevused/väärtused. Reklaami rollid: majanduslik/turunduskil roll-Eesti elanikud on muutunud reklaami suhtes kriitilisemaks, kuid peavad seda enesestmõistetavaks ja normaalseks nähtuseks, millel on majandust soodustav mõju. Reklaam on ühiskonnale vajalik, sest reklaami kaudu saavad ettevõtted tutvustada oma tooteid ning soodustada seeläbi majanduse arengut. Samuti saab reklaamis edastada ühiskonna seisukohalt vajalikke üksikisikut harivaid ja teavitavaid sõnumeid, näiteks suitsetamisvastaseid kampaaniaid või heategevusprojektide reklaame. Küsitl...
rahvusvahelised suhted ning kultuurivahetus, õppimisvõimaluste avardumine jms esitavad Eesti ühiskonnale ja eriti haridussüsteemile keeleõppe ja võõrkeelte oskuse osas järjest suuremaid nõudmisi. Eesti keele arendamise strateegia (2004-2010) peab vajalikuks Eesti võõrkeelepoliitika väljatöötamist. Euroopa keeleõppe raamdokument Euroopa keeleõppe raamdokument on Euroopa Nõukogu mahuka ingliskeelse dokumendi "Common European Framework of Reference for Languages: Learning, teaching, assessment" (Council of Europe 2001) tõlge, mis püüab kõikehõlmavalt kirjeldada keeleõppe valdkonda. Tänaseks on sellest kujunenud alusdokument nüüdiskeelte ainekavakujunduse ja õpivara loomise, õppimise, õpetamise ja keeleoskuse hindamise jaoks Euroopas ja mujalgi. Euroopa keeleõppe raamdokument on ühine alus võõrkeele õppekavade ja nende juhendite, eksamimaterjali, õpikute jms koostamiseks üle Euroopa
SISUKORD 17 SISUKORRA LOOMINE 17 SISUKORRA VÄRSKENDAMINE 17 SISUKORRA VÄLIMUSE MUUTMINE 18 TABELID 18 TABELI LOOMINE ERROR: REFERENCE SOURCE NOT FOUND TABELI LOOMINE TEISE TABELI SISSE 18 LAHTRI, REA VÕI VEERU LISAMINE TABELISSE 19 LAHTRIVEERISTE MUUTMINE TABELIS 19 TEKSTI PAIGUTUSE MUUTMINE TABELIS 19 TABELI RUUDUJOONTE KUVAMINE VÕI PEITMINE 20 TABELILAHTRITE ÜHENDAMINE ÜHEKS LAHTRIKS 20
Viies hiire mingile ikoonile, tuuakse seisundilati asukohale teatavat lühiinfot sellele ikoonile vastava tegevuse kohta. Sellega on paketi AutoCAD ekraanist lühiülevaade antud. Kuna tegelik joonestamine ja süsteemi häälestamine toimub alati teatavate käskude täitmise tulemusena, siis on kasulik teada, et tegevusi saab käivitada: 1) käsurealt käsunime sisestamisega (käskude loetelu kohta vaata käsuga `HELP avane- nud akna valiku Command Reference alamvalikust Commands); 2) käsurealt käsulühendi sisestamisega (lühendite loetelu tuuakse samas alamvaliku Command Aliases juures; lühendid säilitatakse süsteemses failis acad.pgp); 3) rippmenüüst; 4) ekraanimenüüst; 5) ikoonilt (või ikoonilati Object Properties väljadelt); 6) funktsionaalklahvidelt: · F1 `HELP; · F7 `GRID On/Off; · F2 `TEXTSCR/'GRAPHSCR; · F8 `ORTHO On/Off;
5 . Spektroskoopia 5.1 Spektroskoopia teoreetilised alused Spektroskoopia on meetod aatomite ja molekulide iseloomustamiseks nende poolt neelatud, hajutatud ja kiirgunud elektromagnetilise kiirguse pôhjal y a sin(t ) Kvandi energia, sagedus ja lainepikkus, kiirguse vôimsus: sagedus on ajühikus fikseeritud punkti labinud lainepikkuste arv hc 1 E h ; P h h 6 .62 10 34 Js c 3 .00 10 8 m / s Elektromagnetilise kiirguse spekter Ergastus Sisekihi Valentsele Võnkumised Pöörlemised Tuumade molek elektroni ktron spinnid ulis d id Nimetus gamma ...
TARTU ÜLIKOOL Majandusteaduskond Merilyn Ohtla INFLATSIOONI PÕHJUSED, LIIGID, TAGAJÄRJED JA JUHTIMINE Referaat Juhendaja: Nadežda Ivanova Tartu 2015 1 Gh SISUKORD Sd................................................................................................................... 2 SISSEJUHATUS................................................................................................ 2 1.INFLATSIOON............................................................................................... 4 1.1.Põhjused................................................................................................ 4 1.2.Liigid..................................................................................................... 6 1.3 Tagajärjed...................
KORDAMINE ÖKONOMEETRIA KONTROLLTÖÖKS 2013 sügissemester kasutatud 2017. aasta sügissemestri KT õppimiseks Teooria 1. Ökonomeetrilise mudeli komponendid. Endogeensed (sõltuvad Y), eksogeensed (sõltumatud, X), hinnatavad parameetrid (beeta) ja juhuslik komponent ehk vealiige (u) 2. Andmetüübid. Kvalitatiivsed, kvantitatiivsed, ristandmed, aegread, paneelandmed 3. Valimvaatlused ja parameetri hinnangu mõiste. Uuritav objekt on üldvalim, andmebaas on üldjuhul valim. Järledusi teeme üldkogumi kohta ja selleks kasutame valimit. Valimi parameetrite põhjal leitakse üldkogumi parameetrite hinnangud. Valim on juhuvalim, hinnang on juhuslik suurus. Suvaline valimi andmete põhjal arvutatud funktsioon on statistik ning erinevad valimid annavad statistikutele erinevad väärtused. Statistik on juhuslik suurus. 4. Punkthinnang, intervallhinnang. Punkthinnang on ...
simile. Similes appear in the following forms (apart from "like / as / as if"): - in negative forms (e.g. "You are not so unkind as man's ingratitude.") - degrees of comparison (e.g. "He had no more idea of money than a cow.") - adverbial phrase containing (e.g. "With the quickness of a long cat she climbed up") - lexically expressed reference to the fact of comparison (resemble, seem, remind) Many similes have become clichés (e.g. "blind as a bat", "fresh like a rose") 3. Euphemism is a variety of periphrasis. It is a mild, vague expression for a harsh, rude one (e.g. "death" "sleep"). Many euphemisms have become phraseological units: "a gentleman of fortune" (adventurer). More original cases are of greater interest to stylistics. 4
TARTU ÜLIKOOL Majandusteaduskond XXX XXXX EESTI KEEMIATÖÖSTUS VÄLISMAJANDUSTEGEVUSES AASTATEL 2004-2008 Kodutöö aines: Välismajandus Õppejõud: prof Xxxx Tallinn 2011 Sisukord 2 Sissejuhatus Eesti keemiatööstus on olnud tihedalt seotud põlevkivitööstusega, kuid järjest rohkem leiavad arendamist teised keemiatööstuse allharud. Tootmise restruktureerimise tõttu on tööhõive keemiatööstuses pidevalt vähenenud. Kui 1997. aastal töötas keemiatööstuses üle 8 tuhande töötaja, siis tänaseks on hõivatute arv vähenenud üle kahe korra. Müügi ja tootmismahud on jäänud aga praktiliselt muutumatuks ehk tootmismahtu on suudetud hoida tänu tootlikkuse suurenemisele. Kuigi tootlikkus on kiirelt kasvanud, jääb see veel oluliselt alla arenenud riikide näitajatele. Kui lisandväärtus töötaja kohta oli 2005. aastal Eest...
Milliseid märkide tüüpe Te teate? Märk on iga asi või nähtus, mida võib käsitleda kui tähenduslikult millegi asemel olevat. Märkide tüübid on loomulik ja kokkuleppeline. 2) Mis on denotaat ja mis on konnotaat? Kuidas nad seostuvad nn Ogden-Richardsi kolmnurgaga? Denotaat esmane, otsene tähendus. Konnotaat Teine, kaudne tähendus. Konnotatsioon sõltub vastuvõtja kultuurilisest ja isiklikust kogemusest. Symbol (märk) - referent (objekt), denotaat - reference, konnotaat (märgi poolt subjekti teadvuses esilekutsutud mõte sellest objektist). Denotatsioon ,,koer" määrab ära koerad kui klassi Konnotatsioon omaduste hulk, mis koeraga seonduvad 3) Mida mõistetakse semiootikas koodi all? Saussure: kood = keel (nt dresscode, etikett), Jakobson: kood = ühine keel(ühine märkide repertuaar, omane nii sõnumi vastuvõtjale kui saatjale), Eco: kood = märgisüsteem (subkoodide ja kombineerimisreeglite võrgustik, mis
FCE Result Words and Phrases Alphabetical Wordlist a bite to eat (phr) abandon (v) abruptly (adv) absent-minded (adj) abstract (adj) abusive (adj) access (n) accuse of (v) achievement (n) aching (adj) acknowledgement (n) acquire (v) activist (n) adaptation (n) addicted to (adj) addictive (adj) additional (adj) admire (v) admission (n) adoptive (adj) adrenalin (n) adulthood (n) aerial (n) aging (n) aisle (n) alarming (adj) alien (n) alike (adv) allegedly (adv) alley (n) alongside (adv) aloud (adv) alternate (adj) amateur (n) ambitious (adj) anaemic (adj) analysis (n) ancestor (n) ancient (adj) angel (n) ankle (n) announce (v) annual (adj) anthropologist (n) 1 anticipate (v) antisocial (adj) apart (adv) ape (n) apparatus (n) apparent (adj) appeal to (v) appetising (adj) applicable (adj) apprenticed to (adj) approach (v) approximately (adv) arch criminal (n) archaeological (adj) archbishop (n) architect ...
8 Numerous Baroque features of interior design have been later added to to the originally Gothic house, including a mythological painted ceiling to the Rape of Europa theme. The main stairs with a balustrade and a small portrait gallery of the Hueck family (actually copies) enhance the cosy diele. Tallinn City Museum has a model reconstructing the original appearance of the building. With reference to Hueck House, there were a number of spirit and ghost stories and also legends in the Middle Ages. Most of the stories are about the spirit of a monk who was immured in the house and is now restlessly wandering around in the night. Even as late as in 1959 there were still earnest heirs asking "Is the monk still showing himself?" One questioner had heard a story from the people of the house about the beautiful Margaret, daughter of
" 53 Lisa. Programmeerimiskeele AutoLISP funktsioonide tabel Keele AutoLISP funktsioonide kohta saab joonestuspaketi AutoCAD keskkonnas küsida (inglisekeelset) infot, nagu tavaliselt, käsu `HELP kaudu (või väljaspool paketti AutoCAD käivitada fail acad.hlp). Avanenud dialoogakna vahekaardil Contents tuleb nüüd järjekorras täita valikud Visual LISP and AutoLISP, Shortcut link to the AutoCAD Visual LISP Help, AutoLISP Reference ja AutoLISP Reference Overview. Edasine funktsioonide otsing toimub juba tähestiku järgi. Funktsioon Lühiiseloomustus Lk. getpoint punkti küsimine 46 !nimi muutuja jooksev väärtus 54 getreal reaalarvu küsimine 46 lahutamine 40 getstring sõne küsimine 46 * korrutamine 40 getvar süsteemimuutuja väärtus 47
majandusest (börsi kursside ennustamine), meditsiinist (näiteks südameinfarktide ennustamine) jne. 5. Juhtimine Protsesside juhtimine on veel üks tähtsamatest närvivõrkude rakenduste valdkondadest. Olgu mittelineaarse süsteemi dünaamika on teadmata: Plant :{u(t), y(t), kus u(t) on süsteemi juhtimissisend ja y(t) on temale vastav süsteemi väljund. Juhtimise ülesandeks on saavutada nõutavat süsteemi dünaamikat, mida kirjeldab etalonmudel (reference model): Reference model: {r(t),d(t)}, kus r(t) on seadesuurus (juhtimissüsteemi sisend) ja d(t) on soovitav juhitava süsteemi väljund. Närvivõrk peab arvutama sellise juhtimissisendi u(t), et juhitav süsteem jälgiks etalonmudeli poolt määratud soovitava trajektoori: lim ( ) − ( ) = 0 →∞ d t y t t . Tehisnärvivõrkude teoreetilised alused – Üks tähtsamatest teoreemidest närvivõrkude teooriast on Stone-Weierstrassi teoreem, mis tõestab mitmekihiliste pertseptronide
livery colours of the Tudors, the flag was officially recognised only in the 1950s, which is one reason for its exclusion on the Union Jack. St. George's Cross, as an emblem, can be traced back to the 14 th century, when in 1348 Edward III made St. George the patron saint of the Order of the Garter. Later, after the Battle of Agincourt in 1415, Henry V ordered all soldiers siding with the English in military action to wear a band of St. George. The earliest reference to the distinct Saltire (diagonal) Cross of St. Andrew is claimed to date from the 8th century, while its colours evolved four centuries later, in the 12th century. Regarding the Cross of St. Patrick (Northern Ireland), it has been suggested that the red saltire originated from the arms of the Geraldines, one of the influential Anglo- Irish families sent to Ireland to represent Henry II of England. The Cross, which appeared in the 16th century, had a prominent place in their arms. The creation
UNISIST 1971 a algatas UNESCO Ülemaailmse Teadusinfosüsteemi loomise World Science Infotmation System(UNISIST) teadusalane suhtlemine. See on mudel, sotsiaal süsteemi side, mis seisneb teadmistes tootjate, vahendajate ja kasutajate jaoks. LEXIS 1973 a hakkas LEXIS pakkuma online`s USA kohtumatejalide täistekste. LEXIS oli esimene online otsiteenus, mis hakkas 1974 a õppeasutustele õpetamise ajaks allahindlust pakkuma. DATRIX 19661967.a käivitus teenus Direct Access to Reference Information (DATRIX), mis sisaldas doktoriväitekirjade andmeid. DATRIX andmebaasis oli 1967.a. üle 120,000 viite doktoritöödele, mis olid filmitud firma University Microfilm Incorporated poolt. INIS 1970.a aprillis sai International Information System (INIS) vahendusel kättesaadavaks Atomindex, tuumauuringute ja aatomienergia rahuotstarbelise kasutuse alane andmebaas. Käivitus esimene rahvusvaheline infosüsteem, mille keskus asub Viinis Rahvusvahelise Aatomienergia Agentuuri juures
e) transferable securities. 4 8. Participation in securities issues and the provision of services related to such issues 9. Advice to undertakings on capital structure, industrial strategy and related questions and advice as well as services relating to mergers and the purchase of undertakings 10. Money broking 11. Portfolio management and advice 12. Safekeeping and administration of securities 13. Credit reference services 14. Safe custody services. Later more detailed description will be added ... 5.1.4.Summary Everyone can write his or her own. 5.2. Basic Banking To give overview of the movements in bank's balance sheet due to the operations. 5.2.1.Establishing a Bank First, a bank has to fulfil all requirements set for joint stock companies in the country of establishment. Second, special requirements are set for financial and credit institutions almost in all countries in the world
koordinaatide tähistamiseks. Kartograafiline projektsioon - matemaatiline algoritmide süsteem, mille abil kantakse kumera pöördellipsoidi pinnalt geograafilised koordinaadid tasapinnale. Aluseks on seega ellipsoid, mis määrab ära kõik muu. Hetkel kasutatavad tuntumad ellipsoidid: WGS 84 - World Geodetic System 1984 - sellel tugineb GPS ja kasutatakse üsna laialt (varasemad näiteks NAD27 jm) GRS 80 - Geodetic Reference System 1980 - sellel põhinevad enamus suuremõõtkavalisi Eesti kaarte (viimasest ajast) Paljudes piirkondades kasutatakse nn referentsellipsoide, mille kese on parema tulemuse huvides pisut nihutatud. 13. Projektsioonide jaotamine (erinevad viisid: polaar-, kald-, õigepindsed, silindrilised). 1. Proijtseerimisviisi alusel jaotatakse projektsioonid kõige tüüpilisemalt 4 gruppi: a) Ortogonaalne projektsioon – projitseerimine siirdepinnale paralleelsete
Wmr(c) (Rmr(c) = ex- tp) Wc Wmr
Ratio of the material length of the profile Vertical distance between two section levels of Material ratio determined at a profile section
elements Ml(c) at a given level c to the given material ratio. level Rc, related to a reference c0.
evaluation length.
Rmr = Rmr (c 1)
100 m Rc =c(Rmr1) -- c(Rmr2) : Rmr1
2.Exceli vaade...............................................................................................................................................2 3.Põhilised mõisted.......................................................................................................................................2 4.Töö alustamine ja lõpetamine.................................................................................................................... 2 5.Töökeskkonna elemendid ja nende kohaldamine...................................................................................... 3 6.Menüüde lühiülevaade............................................................................................................................... 4 7.Menüüriba..................................................................................................................................................4 8.Nupuribad.................................
Tallinna Reaalkool Tallinna Reaalkooli 131. lennu õpilaste teadlikkus filmimuusikast ja selle funktsioonidest filmides Uurimistöö Alar Järvelaid 11.a Juhendaja: õp Eve Karp Tallinn 2015 1 Sisukor Sissejuhatus.......................................................................................................................4 1. Filmimuusika olemus....................................................................................................6 1.1. Filmimuusika ajalugu.............................................................................................7 1.2. Muusika funktsioonid filmis...................................................................................9 1...
Loosely wrap some rags around now completely full, recheck the level on the onto ramps or jacked up and supported on the oil filter, then unscrew it and immediately dipstick and add more oil if necessary. axle stands (see "Jacking and Vehicle position it with its open end uppermost to 15 Dispose of the used engine oil safely with Support"). Whichever method is chosen, prevent further spillage of oil. Remove the oil reference to "General repair procedures" in make sure that the vehicle remains as level as filter from the engine compartment and empty the Reference Sections at the end of this possible, to enable the oil to drain fully. the oil into the container. manual. 6.4 Engine oil drain plug (arrowed) - 6.7 Oil filter location - CVH engine CVH engine
regulations applying to the products and equipment available in the market today. In particular the differences between the status of the various types of equipment and the differences between the various types of data offered to the users are unclear with respect to the regulations in place. This compendium of facts about chart carriage requirements has been compiled to serve as a reference frame to help resolve the uncertainties existing today. The compendium has been compiled by the Hydrographic Offices of: Denmark, Finland, France (SHOM), Germany, Norway, Sweden and the United Kingdom. The references and interpretation of the international regulations in this compendium and the actual implementation as shown in Annex VI have been verified by: • The Danish Maritime Administration;
puutumatu aluskivim. Tehispinnased C. Looduslik muldkate hävinenud ja ala on kaetud loodusst mittepärineva materjaliga (asfalt, prügi/jäätmed jne). Vajadusel võib jaotada veeolude ja materjali iseloomu järgi. Eesti muldade klassifikatsioonisüsteem on väga lihtne. Muldasid jaotatakse pH, karbonaatide olemasolu ja lõimise järgi. Eesti puhul vaatame erinevad geneetilisi horisonte. WRB- world Reference base. Aluseks diagnostilised horisondid 40. Diagnostilised tunnused 14. Diagnostiliste väärtustega mulla lähtematerjal näiteks lähtekivimi materjal. Jaotatakse kõik mullad selle süsteem järgi 32-ks. Edasine jaotus on iseloomustavate tunnuste ehk modifikaatorite abi kasutatakse ees- ja järelliiteid. Kõik tunnused, mida jälgitakse, on pindmises 200 cm-s kihis. Määramine toimub nagu taimeraamatu järgi, kus vaadtakse tunnuseid ja vaadatakse järjest, kas
Reaves, C. C. (1992). Quantitative Research for the Behavioral Sciences. New York: Wiley. Roomets, S. (2003). Statistika algkursus. Tallinn. Stringer, E. (2004). Action Research in Education. Upper Saddle River: Pearson, Merrill, Prentice Hall. Tooding, L.-M. (2007). Andmete analüüs ja tõlgendamine sotsiaalteadustes. Tartu: TÜ Kirjastus. Yin, R. (2004). The Case Study Anthology. Thousand Oaks: Sage. KASUTATUD KIRJANDUS American Psychological Association (September 5, 2000). Electronic Reference Formats Reccommended by the American Psychological Association. [3. jaanuar 2004]. http://www.apa.org/journals/webref.html Hirsjärvi, S. & Huttunen, J. (2005). Sissejuhatus kasvatusteadusse. Tallinn: Medicina. Hirsijärvi, S., Remes, P. & Sajavaara, P. (2005). Uuri ja kirjuta. Tallinn: Medicina. Jurevits, N. (2003). Rakendusstatistika. Tallinn: Ilo. Kõverjalg, A. (1999). Üliõpilastööde koostamise metoodika. Tallinn: Eesti Riigikaitse Akadeemia. Laherand, M.-L. (2008)
appeal to others. Cant is the language of underworld criminals, tramps. It is a secret language in which the important words are disguised for the outsider not to understand. Used in special meaning e.g. mill (prison), plant (theft), jack (money). There are words that occur in this style only e.g. yegg (criminal), shiv (knife). Vulgar words expressions and words to be widely used e.g. fuck, dick, ass Lexical words usually replaced by euphemisms or by scientific words. The very object or reference is considered vulgar e.g. penis-dick, urinate-piss. Stylistic vulgarism don't express vulgar objects yet, they are inappropriate because they have negative colouring e.g. smeller-nose, plant-bury, flathead-fool Curses damn! Bloody! Shortened forms SOB (son of the bitch) In the direct speech they serve as a means of speech, lack of education, social status. If used in authors' speech the effect is humour, irony.
The later are: · Words belonging to different stylistic groups--colloquial and literary words together (I aint discussing it with my parent) · Using colloquial words when speaking about famous people (That Shakespeare chap) · Mentioning a down-to-earth object side by side with something lofty (they were kissing passionately. The pigs were grunting loudly) Bathos adds humor and irony. Allusion is a reference to something presumably known to the reader--to literature, history, mythology, facts of everyday life, etc. Usually, no indication of source is given. Normally they create festive, solemn implications, but many also result humour if used inappropriately. Often allusions are lost in a text, they are not supplied with the quotation marks. (Mary's lamb--nursery rhyme, Commander Statue--Don Juan) Quotation is a phrase or passage from a literary source often marked by inverted commas
relaxation, and her discourse is once again reminiscent of the post-colonial one: 322 R. Dimitriu As long as I maintain my usual points of reference, my `standards', my sharp observer's distance, life here seems practically impossible. But after a few days Á perhaps because I have no choice Á I yield to a sort of negative capability. I begin to relax into the ambiguity and lassitude of my surroundings as into a bath. [. .
rock sound. The UK saw a release date of October 2000; US fans were treated to a re- sequenced version that autumn. The US version featured a slightly different track listing, adding the aforementioned Bowie version of "Without You I'm Nothing" and the band's cover of Depeche Mode's "I Feel You". The recording spawned additional UK hits such as "Taste in Men" and "Slave to the Wage".[ Placebo encountered resistance from the British music industry upon release of the single "Special K" due to its reference of a ketamine high as a simile for love. The song was released in Australia as a single before eventually being made available in the UK as an EP featuring the B-sides and remixes that would have filled out a conventional two-disc single release. At the time the band claimed this was due to dissatisfaction with the two-disc single format, a claim somewhat undermined by their subsequent single releases all being made available in two-CD formats accompanied by a 7" vinyl.
Renewable Energy 35,p 14-22. Reijnders, L. 2008. Acute View: Transport biofuels: Can they help limiting climate change without an upward impact on food prices. Journal of Consumer Protection and Food Society. Rosegrant, M.W. 2008. Biofuels and Grain Prices: Impacts and Policy Responses. International food and Policy Research Institute Rosillo-Calle, F. Pelkmans, L. Walter, A. 2009. A Global overview of vegetable oils, with reference to bioduiesel. A report for the IEA Bioenergy Task 40. Searchinger, T. Heimlich,R. Houghton,, R.A. Dong, F. Elobeid, A. Fabiosa,F. Tokgoz,S. Hayes,D. Tun-Hsiang Yu. 2008. Use of US Croplands for Biofuel Increases Greenhouse Gases through emissions from land use changes. Service R. 2007. Biofuel researchers prepare to reap a new harvest. Science 2007;31. Scharlemann J,P,W. Laurance, F. 2008. How Green are biofuels? Science, 319. Soetaert, W. Vandamme, E,J. 2009. Biofuels
However, the Library’s unique geometry and small tolerances prohibited this approach. A cumulative tolerance of ½ inch (12.7 mm) was set for the façade system. Seele’s model needed to be extremely accurate, because the structural steel would be offset from the face-of-glass. This meant that the steel detailer had minimal room for error. The goal was to save the bulk of the tolerance for fabrication and erection. The next priority was to establish a common frame of reference, so that all involved parties were dimensioning to the same points. Since the diamonds were a standard size, the architects (OMA/LMN) developed a “key diamond” approach, with the grid layout referenced from a single diamond on each face. Hoffman and Seele did modeling to array the grid geometry up each building face and across the folds, so the architects could select the optimal diamond grid relationships at the corners. The key diamond was set at a
of one or more neighboring frames. The "inter" part of the term refers to the use of Inter frame prediction. Motion compensation is an algorithmic technique used to predict a frame in a video, given the previous and/or future frames by accounting for motion of the camera and/or objects in the video. It is employed in the encoding of video data for video compression, for example in the generation of MPEG-2 files. Motion compensation describes a picture in terms of the transformation of a reference picture to the current picture. The reference picture may be previous in time or even from the future. When images can be accurately synthesised from previously transmitted/stored images, the compression efficiency can be improved. 12. Koodeki, multimeedia konteineri ja metafaili mõisted. Koodek – tarkvara, mis võtab toored andmed ja surub selle kokku (filmil surub kokku heli, teksti ja pildi eraldi). Paneb kokku surutud andmed kokku multimeedia
Use Case Diagramm shows all the ways of using the system; classifiers can now own use cases. Associated Diagrams: activity d.-can be used to model interaction between scenarios. Activity Diagram: Focus on flow of activities involved in a process. Significant changes from UML1.X-now address real time flow,incorporated Petri Net concepts -decompose activity into multiple actions -activity parameters and pins Useful because they focus on workflow-don’t have to reference a prticular object so ideal to map complex alternarive flows in a use case. Visual map of a set of activities and possible transitions between them –activities by one or more operations. Activity Modeling •The sequence and conditions for coordinating other behaviors • … using secondary constructs to show which classifiers are responsible for those behaviors. • Focus is on what tasks need to be done, in what order, rather than who/what performs each task Interfaces UML1
trial detention. As regards the other ground relied on by the Magadan City Court in prolonging the applicant's detention, namely the danger of obstructing the examination of the case, the Court notes that, unlike the order of the investigator of 29 June 1995, the City Court did not mention any factual circumstances underpinning its conclusions, which were identical both in 1996, 1997 and 1999. There is no reference in its rulings to any factor capable of showing that the risk relied on actually persisted during the relevant period. 117. The Court accepts that the interference with the investigation, along with the suspicion that the applicant had committed the offences with which he was charged, could initially suffice to warrant the applicant's detention. However, as the proceedings progressed and the collection of the evidence became complete that ground inevitably became less relevant. 118
using power amplification but without a feedback loop and is described as ,,open loop". The speed of the motor is defined by an input value, it may vary depending on disturbances (load, temperature, supply voltage). The speed range is defined in relation to nominal speed. A Speed regulator is a controlled drive. It features a control system with power amplification and a feedback loop and is described as ,,closed loop". The speed of the motor is defined by a reference value. That value is continiously compared with a feedback signal, which is an image of the motor speed. This signal is supplied either by a tachogenerator or by a pulse generator connected ate the motor shaft end. If a deviation is detected following speed variation, the values applied to the motor (voltage, frequency or both) are automatically corrected in order to restore the speed to its initial value. 37
GGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQAMKPGCTLFFLLCSALTVTTEAHAQTPDTA TTAPYLLAGAPTFDLSISQFREDFNSQNPSLPLNEFRAIDSSPDKANLTRAASKINENLYASTALERGTLKIKSI QMTWLPIQGPEQKAAKAKAQEYMAAVIRTLTPLMTKTQSQKKLQSLLTAGKNKRYYTETEGALRYVVADNGEKGL TFAVEPIKLALSESLEGLNKMTIQQWLFSFKGRIGRRDFWIWIGLWFAGMLVLFSLAGKNLLDIQTAAFCLVCLL WPTAAVTVKRLHDRGRSGAWAFLM VASTUS: Kasutasin programmi Protein-protein BLAST (blastp) Format alignments 500 Sarnased järjestused Database: NCBI Protein Reference Sequences Posted date: Apr 9, 2006 5:23 AM Number of letters in database: 811,773,583 Number of sequences in database: 2,250,671 Lambda K H 0.319 0.133 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2250671 Number of Hits to DB: 127332226 Number of extensions: 4937094 Number of successful extensions: 13884 Number of sequences better than 10: 117
Passel and D’Vera Cohn. Communications support was provided by Katherine Ritchey and Russ Oates. We also received very helpful advice and feedback on portions of this report from Nicholas Eberstadt, Henry Wendt Scholar in Political Economy, American Enterprise Institute; Roger Finke, Director of the Association of Religion Data Archives and Distinguished Professor of Sociology and Religious Studies, The Pennsylvania State University; Carl Haub, Senior Demographer, Population Reference Bureau; Todd Johnson, Associate Professor of Global Christianity and Director of the Center for the Study of Global Christianity, Gordon Conwell Theological Seminary; Ariela Keysar, Associate Research Professor and Associate Director of the Institute for the Study of Secularism in Society and Culture, Trinity College; Chaeyoon Lim, Associate Professor of Sociology, University of Wisconsin-Madison; Arland Thornton, Research Professor in the Population Studies Center,
c) financial futures and options; d) exchange and interest-rate instruments; or e) transferable securities. 8. Participation in securities issues and the provision of services related to such issues 9. Advice to undertakings on capital structure, industrial strategy and related questions and advice as well as services relating to mergers and the purchase of undertakings 10. Money broking 11. Portfolio management and advice 12. Safekeeping and administration of securities 13. Credit reference services 14. Safe custody services. 18. Riski juhtimisega seotud teenused pankades. NÕUSTAMINE & ANALÜÜTIKA |Hindame Teie riske Riski ulatus | Mõõdame teie valuuta-, intressi-ja toormeriske Tundlikkusanalüüs| Tururiskide mõju Teie kasumlikkusele ja finantsnäitajatele Riskide raamistik| Tururiskide tuvastamine ning riskimaandamise põhimõtete koostamine Strateegiate testimine | Riskimaandamise strateegiate hindamine ajaloo põhjal
reklaamipsühholoogia Reputatsioon klientide, investorite, töötajate ja avalikkuse emotsionaalne reaktsioon ettevõtte nime kuuldes. Maine pole midagi rohkemat ega vähemat kui peegeldus sellest, mida peetakse eetiliseks konkreetses ühiskonnas teatud aja jooksul Maine ja imago ei ole toote küljes kinni. Ei ole nende objektiivne omadus. Reputatsiooni ei saa 100% kontrollida, saab aga juhtida. Saab anda endast parima, et suunata oma ettevõtte mainet nö positiivse suunas. Konkreetse ettevõtte või toote puhul n oluline faktor ka collective reputation of the industry st tööstusharu või tootekategooria maine üldiselt. Milleks maine kujundamine? Tänapäeval on mainega tegelemiseks ka nn stakeholder's society kjunemine ja sotsiaalse meedia jõulisus. Maine on konkurentsieelis sellega saab tõdeda, et maine, kui selline, muutub oluliseks siis, kui tekib konkurentsisituatsioon. Maine juhtimisel arvestatakse sidusgruppidega. Reputation Quotient main...
Rennie, J., Roberton, N. 1999. Textbook of neonatology. Edinburgh: Churchill Livingstone: Harcourt Brace and Company Limited Rogers, M. C.(toim.) 1987. Textbook of Pediatric Intensive Care. Baltimore: Williams & Wilkins, 62-84 Rogers, M. C., Helfaer, M. A. 1999. Handbook of Pediatric Intensive Care. Baltimore: Williams&Wilkins, 54-57 Roper, N., Logan, W. W., Tierney, A. J. 1999. Õendusealused. Tartu: Elmatar, 137-144 Rusconi, F., Castagneto, M., Gagliardi, L. (1994.) Reference values for respiratory rate in the first 3 years of life.// Pediatrics, 94, 350-355 Sadowski, R., Dechert, R. E., Bandy, K. P., Juno, J., Bhatt-Mehta, V., Custer, J. R., Moler, F. W., Bratton, S. L. (2004.) Continuous Quality Improvement: reducing unplanned extubations in a pediatric intensive care unit.// Pediatrics, 114, 628-632 Scales, K., Pilsworth, J. (2007.) A practical guide to extubation. // Nursing Standard, 22(2), 44-48 Schell, K. A. (2006
switched networks G.711 64 kb/s; G729A- 8kb/s; G.726 32kb/s <- multimeedia ülekanne (standardid)kõnesignaali koodek Transpordikihi protokollid. TCP - Transport Control Protocol; pakub usalduväärse ühenduspõhise ja baitide arvu loendava masinatevahelise (ITU-T G.729A, 8 kbit/s) Ribalaius Hz; OSI - Open Systems Interconnection Basic Reference Model - is a layered, abstract description for communications and computer transporditeenuse. Usaldusväärsus tähendab praktikas seda, et TCP tagab sõnumite kulgemise nende saajale kviteerimismeetodi abil. UDP - User Datagram
pane kirja ülemuse ametlikud kohtumised - mark down all you'r boss's engagements arved, mida tuleb maksta - accounts to be paid pööra tähelepanu isiklikule välimusele - pay attention to your personal appearance küllaltki lai äär - a margin wide enough kontrolli õigekirja - (to) check spelling hoidu vigadest ja kohmakatest parandustest - avoiderrors and clumsy corrections väldi ebatasast äärt - avoid eneven margins hoia saadaval hea teatmekirjandus - keep a good reference library available pea lauapäevikut - keep a desk diary tegevuse meeldetuletus - reminders of action to be taken igaaastased sündmused - annual events ole valmis kõigeks sinu ümber - keep alert to everything happening around you 23 sekretär kuuleb - secretary speaking me saime telefoniteate - we received a telephone message taevasinine pluus - a sky-blue shirt kohalik organisatsioon - a local organization kui ametlik sa oled - how formal you are
siis metallide A ja B termo-emj on EAC + ECB (joonis 2.146, d). 5. Kui termoahela emj on E1 liitekohtade temperatuuril T1 ja T2 ning E2 temperatuuril T2 ja T3, siis liitekohtade temperatuuril T1 ja T3 summaarne emj on E1 + E2 (joonis 2.146, e). 27. Võrdluspunkti mõiste temperatuuri mõõtmisel termopaari abil Temperatuuri mõõtmisel termopaaridega kasutatakse tavaliselt termoahelat kahe liitekohaga, millest üks on mõõteühendus, teine aga võrdluspunkt (ingl reference junction), mille temperatuur on täpselt teada. Termopaaride kalibreerimisel on selle võrdluspunkti temperatuuriks jää sulamise temperatuur (0 °C). Kui mõõtmiste ajal võrdluspunkti temperatuur erineb sellest kalibreerimistemperatuurist, siis viies termoahela seadus võimaldab leida mõõtetulemusele vastava temperatuuri arvutuslikul teel. Temperatuuri täppismõõtmisel tuleb termoahela võrdluspunkti temperatuuri hoida võimalikult konstantsena
Küsimus 1 Läbipääsusüsteem sissepääsu ukse juures fikseerib, kes ja mis kell on tööle tulnud või töölt lahkunud. Millise süsteemiliikiga on tegemist? Vali üks: a. Expert System b. Decision Support System c. Management Information System d. Transaction Processing System Küsimus 2 Tegevus "Alternatiivide võrdlemine" on seotud järgmise SLDC etapiga: Vali üks: a. Süsteemi analüüs b. Süsteemi planeerimine ja valik c. Süsteemi teostus ja kasutamine d. Süsteemi disain Küsimus 3 Systems planeerimine ja valik on seotud järgmiste tegevustega: Vali üks või enam: a. Süsteemi piirete ja mahu määramine b. Parima lahenduse soovitamine c. Dokumentatsiooni koostamine d. Nõuete kindlakstegemine e. Vajaduse identifitseerimine Küsimus 4 Infosüsteemi arendamise elutsükkel on sammude jada, mis on vajalik infosüsteemi arendamise haldamiseks. Mis on elutsükli neljas samm? Vali üks: a. Infosüsteemi väljavalimine ja planeerimine b. Infosüsteem...