0556 Lennunduse side- ja navigatsiooni süsteemide käitamise eriala A3 Üliõpilane: "....." ............... 2011. a ........................Mihkel Mandel Juhendaja: "....." ............ 2011. a ........................lektor Mart Hovi Tartu 2011 ABSTRACT Mandel, M. Cross-section of an automobile's engine control unit as a learning material of infotechnology. Tartu: EMÜ, 2011. XX pages, XX figures, X tables, format A4. In Estonian language. In the current coursework I have pointed out modern automobiles most important detail, it's ECU(Engine Control Unit). This is absolutely most complicated electronical device at all in a car. Also I define it's meaning, purposes, what it has to do in a car, which components are used to create a such smart device. The main purpose of this coursework, is to explain how cars engine most important
37. management board juhatus 38. rights and obligations are created, amended, terminated õiguseid ja kohustusi looma, muutma, lõpetama 39. void tühine 40. in contradiction with good morals vastuolus heade kommetega 41. ostensible näilik 42. relevant mistake oluline eksimus 43. fraud pettus, kelmus (making a wrong statement to someone in order to make him or her do sth which will harm him, e.g. lose money) 44. cancel tühistama (tehingut) 45. freedom of the format of a transaction tehingu vormivabadus 46. certified by a notary public notariaalselt tõestatud 47. unattested written form lihtkirjalik vorm 48. hand-written signature käsikirjaline allkiri 49. electronic signature elektrooniline allkiri 50. agent (representative) esindaja 51. right of representation esindusõigus 52. arise from law seadusest tõusetuma/tulenema 53. right of representation granted by transaction tehingust tulenev esindusõigus 54
1. Milline on esmane dokument laeva laadimiseks? Kes selle koostab ja kooskõlastab? Esmane document laeva laadimiseks on laadimiskorraldus ning selle väljastab kaubasaatja või selle ekspediitor. Selles näidatud andmed on teatud määral (koos sellesse kantud vedaja märkustega) aluseks konossemendi vormistamisel. Näidatakse kaubasaatja/saaja, laev, sadamad, lõplik sihtpunkt, konossemendi originaalide arv, kauba kirjeldus jne. 2. Mida kujutab endast mõiste "Tüürimehe kviitung" (Mate's receipt) ? Mis on tema juriidiline olemus? Sellenimelise iseseisva dokumendina esineb suhteliselt harva. Tavapäraselt muutub sisuliselt selleks kaubasaatja/ekspediitori poolt väljastatud laadimiskorraldus peale laeva esindaja (tüürimehe) tõestamist oma allkirjaga, et kaup on laadimiskorralduses näidatud kaup on vastavas (või teises) koguses ja seisundis laeva poolt veoks vastu võetud. 3. Mida tähendavad lühendid konossemendis "s....
communications peripheral port’s Controllers Programming parameters. communications Manual (W353). parameters. Mode: Host Link Standard format 1 start bit 7-bit data Even parity 2 stop bits 9,600 bps baud Transmission delay: None
Võru Kesklinna Gümnaasiumi uurimistööde koostamise juhend Juhendi koostamisel on kasutatud Eesti Ajalooõpetajate Seltsi ja Tartu Descartesi Lütseumi juhendeid Uurimistöö on kõige kasulikum praktilise väljundiga õppetöö vorm Soovitusi uurimistöö koostamiseks 1. Mis on uurimistöö? Uurimistöö on uurimusliku protsessi konkreetne tulemus- kirjalik aruanne sellest, mida uuriti, kuidas uuriti ning millised on järeldused ja tulemused, milleni töö käigus jõuti; protsess ja töömeetod, mille käigus analüüsitakse uuritavat probleemi süstematiseeritud ja asjakohaselt struktureeritud viisil. Uuring - lühiajaline v. ühekordne andmete kogumine, piiratud mahuga uurimisülesanne. Uurimus - trükis ilmunud v. kirjalik uurimistöö. Kodu-uurimistöö - on uurimuslik töö, mille temaatikaks on oma kodukandi v. mõne muu piirkonna (nii ajaloo kui tänapäeva, loodus- kui inimkeskkonna) uurimine. Referaat ...
ilmuvat kohtspkirit (tooltip). 19 Google SketchUp HKHK / Mario Metshein 4.3 Mõõtudega ristkülik Edaspidi on meil kindlasti mõni objekt või detail joonistada soovitud mõõtmetega. Kõigepealt veendume, et meil on ikka ühtemoodi mõõdud. kui programm on avatud, vali menüüst Window>Model Info avanenud aknas vali Units o Format: Decimal, Meters o Precision: 0,00m (määrab täpsusastme) Harjumatult võib puududa OK nupp, seepärast piisab lihtsalt 'ristist' sulgemine Erinevalt proffesionaalsetest programmidest, ei küsita mõõtusid automaatselt. Teeme näiteks ristküliku 2x1m ristküliku. Vali Rectangle tööriist Pane paika ristküliku üks nurk ja ära teist klikki tee Nüüd kirjuta klaviatuuri abiga 2;1 ja vajuta Enter-klahvi
Kaks lugu, kus Taylor osales, "Two Is Better Than One" Boys Like Girls´ilt ja Jon Mayer´i "Half of My Heart" jõudsid edetabelis vastavalt 40. ja 25. kohale. Need kaks singlit on ta 21. ja 22. Top 40 singlite hulgas. "Fearless" album oli parimmüüdud album 2009. aastal Ameerikas, 3.2 miljoni koopia müügiga aastas. Swift tõusis 1. ja 2. kohale Nielsen´s BDS Top 10 Most Played Songs edetabelis kõikide zanrite hulgas, "You Belong With Me" ja "Love Story"ga. Ta jõudis ka All Format 2009 Top 10 artistide edetabeli tippu ja Top 10 Artist Internet Steams edetabelisse üle 46 loo mängimisega online´s. Swift avaldas loo "Today Was a Fairytale" digitaalallalaadimisena iTunes´is 19. jaanuaril 2010.aastal. Lugu oli ka filmi "Valentine's Day" soundtrackis, kus ta ka ise näitles. Lugu jõudis Billboard Hot 100 edetabelis 2. kohale, tulles tema 6. Top 10 ja 23. Top 40 edetabeli singliks. Põhinedes Nielsen SoundScan andmetele, müüdi "Today Was a Fairytale"i
country ISO1302-'78 Specification former Japan former U.S.A. former France former ISO Profile format Analog signal Analog signal with Analog signal Analog signal Primary without filtering low pass filtering without filtering without filtering profile P 1 sampling length
But perhaps most important, sensitive teaching that relies on constructivist approaches and actively guides children toward important discoveries that support their pictorial efforts translates into sense of accomplishment and pride that sustains children's interest in creative endeavors and encourages them to continue to use and further master this medium of representation. These recommended forms of adult intervention and teaching can be easily integrated into the play format, and skillful and sensitive teachers can make a tremendous difference in children's artistic growth without compromising the child- centered emphasis and the relaxed and playful atmosphere in their childhood classrooms. What is needed, however, is paradigm shift from understanding the concept of developmentally appropriate art education in terms of curricula targeting children's actual levels of attainment to that of creating environments that allow children to perform within their
BBC | British Council Think. Planning a writing lesson Page 1 Genre analysis form Look at the 3 letters. Use the categories given below to analyse them and find the key characteristics. Give examples where possible, for example, of grammar structures or vocabulary used. · Communicative purpose (What does the writer hope to communicate /achieve?) · Expected audience (Who will read it?) · Layout (general format e.g. does it have a title? What appears where on the page?) · Overall organisation (e.g. what type of information is included in each paragraph?) · Level of formality (formal / informal / semi-formal? Give examples from the text) · Sentence structure (e.g. complex or simple) · Specific grammatical structures (e.g. do any specific tenses predominate?)
Tallinna Tehnikaülikool Informaatikainstituut Tõõ Andmed ja valemid Üliõpilane Õppemärkmik Õppejõud J. Vilipõld Õpperühm Palun täitke tühjad lahtrid MASB11 Harjutused Andmete tüübid Excelis Valemid ja avaldised Funktsioonid Arvandmed, -avaldised ja -funktsioonid Aadressite ja nimede kasutamine valemites Arvavaldised - tehete prioriteedid, funktsioonid Minirakendus "Detailike" - ülesande püstitus Minirakendus "Detailike" - aadresside kasutamine Minirakendus "Detailike" - nimede kasutamine Pildi hind Loogikaandmed, -avaldised ja funktsioonid Võrdlused ja loogikatehted IF-funktsioon Funktsioonid Palk & Kauba hind Viktoriin_1 Tekstandmed, -avaldised ja funktsioonid Ajaandmed, -avaldised ja -funktsioonid Ülesanded Kolmnurga karakteristikud Prisma silinder Arvvalemid Ruutvõrrand Intressi arvutamine P...
Metaandmed - (inglise keeles metadata) on mingeid andmeid kirjeldavad andmed ehk nii-öelda andmed andmete kohta. Veebilehe kontekstis info veebilehe sisu kohta. Metaandmete lisamiseks kasutatakse HTML dokumendi päises elementi. Sellel elemendil on kohustuslik atribuut content, milles on kirjas konkreetne metaandmete sisu ning valikulised atribuudid, mis on content atribuudiga seotud PDF – Portable Document Format, dokumentide universaalne lõppformaat, mis on orienteeritud dokumendi väljastamisele ja säilitamisele. PHP - Veebiserveri poolne skriptikeel Sessioon - Talitluslikult terviklik töötsükkel dialoogsüsteemis või andmesides. Seanss kujutab endast kestvat ühendust kasutaja (või kasutaja agendi) ning partneri vahel, kelleks on enamasti server. Seansi vältel toimub harilikult suure hulga pakettide vahetamine kasutaja arvuti ja serveri vahel. Seanss on harilikult üks võrguprotokolli
Men" and "Slave to the Wage".[ Placebo encountered resistance from the British music industry upon release of the single "Special K" due to its reference of a ketamine high as a simile for love. The song was released in Australia as a single before eventually being made available in the UK as an EP featuring the B-sides and remixes that would have filled out a conventional two-disc single release. At the time the band claimed this was due to dissatisfaction with the two-disc single format, a claim somewhat undermined by their subsequent single releases all being made available in two-CD formats accompanied by a 7" vinyl. Their style altered little from Placebo through Black Market Music, based around fairly straightforward guitar playing, often influenced by the style of 1970s British and American rock, and Molko's high-pitched vocals. The first single for the album, "Taste in Men", was one of their most popular, with a trance synthesiser in the background and wailing distorted
There was an interest in symmetry, clear definition of shape, immaculate surface and formal order. This was opposed to the unrestricted and spontaneous character of Action Painting. "Hard-edge" was associated with this style. Chromatic abstraction spread wide in the late 1950s. Exemplary artist. Ellsworth Kelly (mid-C20). His hard-edge forms were scrupulously clean of any detail and surface irregularity. He established relationships between large and bold shapes in a simple format, in their "shaped canvases" (unconventional shapes). He created a mode of painting in three dimensions which was opposed to Expressionism and Action Painting. Subsidiary artists: Sam Francis, Helen Frankenthaler, Morris Louis, Kenneth Noland. Op Art. Op Art spread during the 1960s. It was a revolt against the reign of Abstract Expressionism. These artists drew upon scientific materials from optics and psychology to create illusions of movement and distortions of form.
There was an interest in symmetry, clear definition of shape, immaculate surface and formal order. This was opposed to the unrestricted and spontaneous character of Action Painting. "Hard-edge" was associated with this style. Chromatic abstraction spread wide in the late 1950s. Exemplary artist. Ellsworth Kelly (mid-C20). His hard-edge forms were scrupulously clean of any detail and surface irregularity. He established relationships between large and bold shapes in a simple format, in their "shaped canvases" (unconventional shapes). He created a mode of painting in three dimensions which was opposed to Expressionism and Action Painting. Subsidiary artists: Sam Francis, Helen Frankenthaler, Morris Louis, Kenneth Noland. Op Art. Op Art spread during the 1960s. It was a revolt against the reign of Abstract Expressionism. These artists drew upon scientific materials from optics and psychology to create illusions of movement and distortions of form.
Bioinformaatika ülesanded Järjestuste võrdlemine, otsingud andmebaasidest (BLAST, FASTA, SW). 1. BLAST programmide kasutamine tundmatu valgujärjestuse identifitseerimiseks või sarnaste valgujärjestuste leidmiseks (http://www.ncbi.nlm.nih.gov/BLAST/). Programmide kasutamisel tutvuda tutorialite ja juhenditega!!! (http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/information3.html). a. Otsida sarnaseid järjestusi antud valgujärjestusele. Valida sobiv programm vastavalt NCBI juhendile valgujärjestuse võrdlemiseks valgujärjestuste seast. Valida otsimiseks Refseq andmebaas, sooritada otsing, tulemuste formaat 500 joondamise jaoks. GTESPLLTDPSTPNFFWLAWQARDFMSKKYGQPVPDRAVSLAINSRTGRTQNHFHIHISCIRPDVRKQLDNNLAN ISSRWLPLPGGLRGHEYLARRVTESELVQRSPFMMLAEEVPEAREHMGRYGLAMVRQSDNSFVLLATQRNLLTLN RASAEEIQDHQCEILRMRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEM...
TALLINNA ÜHISGÜMNAASIUM KUMMALINE HAIGUS EPILEPSIA Uurimustöö bioloogias Koostaja: Agnes Poom 11.C klass Juhendaja: Leili Järv Tallinn 2012 Mõisted...................................................................................................................................... 3 Sissejuhatus................................................................................................................................4 Epilepsiast..................................................................................................................................5 Mis on epilepsia tekkimise põhjuseks?..................................................................................6 Kas epilepsia on üksnes inimeste haigus?............................................................................. 6 Epileptilised hood................................
In addition, since the actual properties are available, areas where building components clash can be picked up by the software. Intelligent documents have the ability to provide material quantity data for the project (Smilow, 2007). Although the Building Information Model is mostly conveyed in the form of a 3D visualization, it is merely a mechanism for communicating the stored information in a concise and attractive format (Kostura, 2009). 1.4. Building Information Modeling in The United States Although BIM has been on the market for a number of years, it has not been adopted industry-wide to its full capacity. As of 2009, approximately half of industry 10 representatives were not using any BIM software on projects in the U.S (McGraw Hill 2009).
·If server fails prior to voting, it aborts. ·If it fails after voting, it sends GetDecision. ·If it fails after committing it (re)sends HaveCommittedmessage. 23. Major Data Warehousing Activities ·Data extraction-obtaining data from operational and other data sources. ·Data transformation-since the data is extracted from a variety of different systems and formats, it must be cleansed and standardized into a common format. ·Data access and presentation-provides a variety of ways for users to view the data . 24. Data Warehousing Components ·Data Migration Tools source data access, data transformation ·Metadata repositories source data description, transformation definitions ,data currency ·Warehouse Database integrated, subject-oriented, multidimensional ·Data Warehouse management data administration, changes/modifications, etc., process administration ·Data Access and Delivery
Summary The Chelsea Flower Show has its roots in a Kensington Garden in 1862 when it was known as the RHS Great Spring Show. Fifty years later, the show moved to its current location at the Royal Hospital in Chelsea. The Chelsea Flower Show is the flagship event in the UK gardening calendar and is the start of the RHS Big Three - Chelsea, Hampton Court and Tatton. The show was a mere three days long until 1925 when it changed to its current five- day format. There is talk of an extra day being added next year to cater to the increased demand for tickets. In the days leading up to the show the site is a frenzy of activity. Chelsea still lives up to its billing as the greatest flower show on earth, how- ever, and this is because of the sheer quality of the plants on display. In recent times the show gardens have taken centre stage-this year look out for entries from Tom Stuart-Smith,
Leia maksud kokku (kogus korrutada maksudega). 297.00 € 6. Liida kõik rendid kokku. - € 7. Liida kõik puhkusetasud kokku. 726.00 € 8. Liida kõik maksud kokku. - € 9. Vorminda Maksud kokku veerus olevad andmed kahe komakoha ja € tähisega. Märgista andmed ja 89.10 € vali Home menüüst Number grupist käsk Accounting - € Number Format. (Avaleht-Arv-Raamatupidamise 79.20 € arvuvorming) - € 10. Vorminda L1 lahtris olev arv kuupäeva vorminguga. 252.45 € Märgista lahter ja vali Home menüü Number grupi - € ripploendist Short Date. (Avaleht-Arv-Kuupäev) 11. Grupeeri töölehed Kulud3 ja Kulud2 ning muuda B5 759.00 € lahtris oleva 1720 m mõõtühik millimeetriks. Hoides
Andmed ja valemid Excel'is id Excel'is Andmete tüübid Excelis Valemid ja avaldised Funktsioonid Arvandmed, -avaldised ja -funktsioonid Aadressite ja nimede kasutamine valemites. Harjutus "Kolmnurk" Harjutus "Täisnurkne kolmnurk " Arvavaldised - tehete prioriteedid, funktsioonid Loogikaandmed, -avaldised ja funktsioonid Võrdlused ja loogikatehted Võrdlused ja loogikatehted. Harjutused IF-funktsioon Palk & Kauba hind Funktsioonide tabel Minirakendus "Detail" - ülesande püstitus "Detail" - kasutajaliides "Detail" - materjalid "Detail" - värvid Ajaandmed, -avaldised ja -funktsioonid Tekstandmed, -avaldised ja funktsioonid Lisad Nimede määramine ja kasutamine Valideerimine Matemaatikafunktsioonid Tekstifunktsioonid Loogikafunktsioonid Ajafunktsioonid Otsimine. Funktsioon VLOOKUP Valemiredaktor MS Equation 3.0 ...
VLAN-e sisaldav vituaalne kohvõrk võib koosneda mitmest kommutaatorist kommutaatorite vahelised ühendused võivad kanda mulipleksitult korraga mitut VLAN-i. selleks on VLAN-tagging Standard IEEE 802,1Q defineerib viisi kaadrite märgistamiseks Kaadrite märgistamine Kaadri tüübi välja ette lisatakse 32-bitine väli o 16-bit protocol ID (TPID) 0x8100 o 3-bit prioriteet (PCP) (1 madalaim, 7 kõrgeim) o 1-bit Canonical Format Indicator (CFI) = 0 o 12-bit VLAN ID 1-4094 0 - ei kuulu ühtegi VLAN-i 4095 ehk 0xFFF on reserveeritud Kaadrite märgistamise protokollid: o IEEE 802.1Q o ISL (inter-Switch Link) o DISL (Dynamic Inter-Switch Link) Neid protokolle nim trunking protokollideks Kommutaatorite vahelisi ühendusi, mis kannavad mitut VLAN-i nim VLAN Trunk VLAN Trunk seadistamine
Netvibes, Pageflakes) võimaldavad tellida ja kombineerida tegevusest teada anda.• Meedia ei ole mingil juhul kuulekas kanal kellegi sõnumi edastamiseks, vaid pigem erinevaid infovooge vastavalt infotarbija vajadustele.töötavad teatud infovahetusstandardite: RSS ehk Realy kommu eraldiseisev sihtgrupp, kellel tulenevalt erilisest positsioonist ühiskonnas on suurem mõju muude Simple Syndication (xml, rss, rdf), Atomfeed – Atom Syndication Format (atom) alusel, tõmmates kasutajani sihtgruppide arvamuste kujunemisel. elemente - artiklite pealkirju ja artikli algusest pärinevat tekstilõike, pilte ning linke artiklite tõelise asukohani, Ms võib jagada proaktiivseteks ja reaktiiveteks. Proaktiivsete meediasuhte puhul on tegemist sõnumi edastaja terviktekste. Sellist edasitoimetamise viisi nim. sündikatsiooniks.
Tartu Emajõe Kool ÕPILASUURIMUSE JA PRAKTILISE TÖÖ KOOSTAMISE JA VORMISTAMISE JUHEND Tartu 2015 Sisukord SISSEJUHATUS................................................................................................................................ 4 1. UURIMUSTÖÖ KOOSTAMINE .............................................................................................. 5 1.1. Uurimustöö olemus ................................................................................................................. 5 1.2. Teema valik ja eesmärgipüstitus ............................................................................................. 5 1.2.1. Hüpoteesi või uurimisküsimuse sõnastamine................................................................... 7 1.3. Kirjandusega tutvumine ....................................................................................................
Parse(tekst1); Console.WriteLine(arv1); } } Veateatest võib välja lugeda, et klassi Erind1 käsklusest Main kutsuti välja System.Number.ParseInt32, mis omakorda kutsus välja käsu StringToNumber. Viimane aga jäi teksti arvuks muutmisega hätta. Anti välja veateade tüübist System.FormatException koos selgitusega, et etteantud sõne pole sobival kujul. /* C:Projectsomanaited>Erind1 Unhandled Exception: System.FormatException: Input string was not in a correct format. at System.Number.StringToNumber(String str, NumberStyles options, NumberBuffer& number, NumberFormatInfo info, Boolean parseDecimal) at System.Number.ParseInt32(String s, NumberStyles style, NumberFormatInfo info) at Erind1.Main(String[] arg) */ Vähemasti saime teada mis juhtus, aga kasutaja ei pruugi sellise teatega kuigivõrd rahul olla. Eriti, kui tuleb ette süsteemne veateateaken, mis püüab andmeid kuhugile saata või programmi siluma hakata ning keeldub eest ära minemast
When the other systems on the network receive the transmitted data, their data-link layer protocols process it and pass it up to the network layer. By far the most popular data-link layer LAN protocol in use today (and throughout the history of the LAN) is Ethernet. Token Ring is a distant second, followed by other protocols such as the Fiber Distributed Data Interface (FDDI). Data-link layer protocol specifications typically include the following three basic elements: * A format for the frame (that is, the header and footer applied to the network layer data before transmission) * A mechanism for controlling access to the network medium * One or more physical layer specifications for use with the protocol Frame Format - The data-link layer protocol encapsulates the data it receives from the network layer protocol by adding a header and footer to it, forming what is called a. Using the mail analogy given
• IM: workaroundid, tuntud vead • ChM: RfC • CpM: lahendatud Cp probleemid • AM: lahendatud A probleemid 3) Seleta lahti mõisted/lühendid: FTA, RTO, LTO, CAB, RAID-1, IMAP4, KPI, CRM FTA – Fault Tree Analysis - Veapuu analüüs. Võimaldab leida kriitilised teenused/funktsioonid. Kasutatakse probleemini viiva sündmuste ahela koostamiseks RTO – recovery time objective - Kui palju aega kulub andmete taastamiseks LTO – Linear Tape Open - Magnetlindile salvestamise Open format tehnoloogia kuni 6.4 TB, ülekandekiirus 540 MB/s CAB – Change Advisory Board - Muudatuste nõukogu. Koosneb IT teenuseosutaja erinevatest valdkondade, äripoole ja kolmandatest isikutest. RAID-1 – Redundant Array of Disks -Andmed kirjutatakse kahe või rohkemate ketaste peale. Iga ketas võib teenindada päringut. Komplekt töötab nii kaua kuni vähemalt üks ketas on töötav. Aeglasem, sest igat ketast tuleb uuendada.
general across a language. British National Corpus, Estonian – French Parallel corpus 53. Concordance line A concordance line is an alphabetical list of principal words used in a body of text with their immediate contexts. They are frequently used in linguistics for various vocabulary- related treatises. 54. KWIC Key Word in Context (acronym) is the most common format for concordance lines. Concordance is an alphabetical list of the principal words used in a body of text with their immediate contexts. The term was coined by H.P Luhn A database search in which the keyword is shown highlighted in the middle of the display, with the text forming its context on either side. 20
1. nädal • Eksamiks: pead teadma suuruse-numbreid ja mida nad tähendavad: bitt, bait, kilobait, megabait jne; oskad selgitada, kuidas tähti kodeeritakse, mis on algoritm ja mis programm. Ajaloost: Kreeka loogikud, induktsioon, deduktsioon, süllogismid, lausearvutus (pead mh oskama tõeväärtustabelit koostada), Pascal, Leibniz, perfokaardid, kangasteljed, Babbage, Hollerith, colossus ja saksa krüptomasinad, Turing, Shannon, Zuse, esimesed programmeeritavad arvutid. Algoritm – täpne samm-sammuline, kuid mitte tingimata formaalne juhend millegi tegemiseks. Nt toiduretsept, juhend ruutvõrrandi lahendamiseks. Programm – formaalses, üheselt mõistetavas keeles kirja pandud algoritm. Arvutid suudavad täita ainult programme. Bitt – info mõõtmise ühik, tuleb mõistest binary digit – nö kahendarv kahe võimaliku väärtusega 0 ja 1. Saab näidata kahte võimalikku olekut. Nibble - 4 bitti. Bait – arvutite...
Andmebaaside eksam Erinevat tüüpi andmemudelid Andmemudelite väljatöötamise ajaline järjekord (vanemast nooremaks) 1. Hierarhiline andmemudel (vanim) 2. Võrk-andmemudel 3. Relatsiooniline andmemudel 4. Objekt-orienteeritud andmemudel 5. Objekt-relatsiooniline andmemudel (noorim) Hierarhiline - Andmed on organiseeritud hierarhiatena. Hierarhiline andmemudel väljendab oma alamobjektide 1:M suhteid ja talle vastavaks abstraktseks andmestruktuuriks on "puu". Puudused: - Andmete dubleeritus. (Ametite andmed on dubleeritud. Näiteks autojuhi ameti andmed on kahes puus.) - Andmete lisamise anomaaliad. (Kuni pole leitud sobilikku töötajat, ei saa sisestada ameti kirjeldust.) - Andmete kustutamise anomaaliad. (Kui kustutada andmebaasist Tarmo, kaovad koos temaga ka remondimehe ameti andmed.) Hierarhilises andmebaasis on andmed organiseeritud hierarhilise mudeli alusel....
min after the TSST. The whole blood was centrifuged (250g for 10 mins) and the resulting plasma layer was removed, aliquoted and stored at 70 oC for cytokine analysis. All samples were numerically coded (known to the principal investigator) and laboratory measurements (see below) undertaken blind. 2.3.1 Detection of Plasma IL-6 Plasma IL-6 was detected using commercially available paired antibodies enabling cytokine detection in an ELISA (Enzyme Linked ImmunoAssay) format (R & D systems Ltd, Abingdon, UK). The sensitivity for the IL-6 ELISA was 9 1000 pg/ml. There was no reported cross-reactivity with other cytokines (R & D systems Ltd, Abingdon, UK). Emotion regulation in relation.. 1 2.3.2. Detection of Salivary Cortisol Salivary cortisol was dectected using a commercially available ELISA (Salimetrics, LCC, USA). Briefly, a 96-well microtitre plate coated with monoclonal antibodies to
and storage of a large number of networked computers. Most p2p systems have been personal systems but there is increasing business use of this technology. Torude ja filtrite arhitektuur Eelised: Easy to understand and supports transformation reuse. Workflow style matches the structure of many business processes. Evolution by adding transformations is straightforward. Can be implemented as either a sequential or concurrent system. Puudused: The format for data transfer has to be agreed upon between communicating transformations. Each transformation must parse its input and unparse its output to the agreed form. This increases system overhead and may mean that it is impossible to reuse functional transformations that use incompatible data structures. Komponentidel põhinev arhitektuur Eelised: Laiendatav: uusi komponente saab lisada vastavalt vajadusele Asendatav: komponente on kerge asendada Paindlik ja skaleeritav Taaskasutatav
readLine()) != null) { väljundvoog.println(l); } } finally { if (sisendvoog != null) { sisendvoog.close(); } if (väljundvoog != null) { väljundvoog.close(); } } } } Puhvrist teele · kui täis · meetod flush() - uhtuma · teatud meetoditega - println() · Klass PrintWriter 1. realiseerib liidese Flushable 2. loomisel saab märkida, kas iseuhtumine (autoflush) toimib 3. meetodid println , printf ja format Klass System System.in vaikimisi klaviatuurilt System.out, System.err vaikimisi ekraanile (konsoolile) Muudame väljundit: OutputStream output = new FileOutputStream("c:\temp\systemout.txt"); PrintStream printOut = new PrintStream(output); System.setOut(printOut); Andmete kirjutamine faili: DataOutputStream dos = new DataOutputStream(new FileOutputStream("c:/temp/andmed.bin")); dos.writeInt(25); dos.writeDouble(5.22); dos.close(); Veebist
Parse(tekst1); Console.WriteLine(arv1); } } Veateatest võib välja lugeda, et klassi Erind1 käsklusest Main kutsuti välja System.Number.ParseInt32, mis omakorda kutsus välja käsu StringToNumber. Viimane aga jäi teksti arvuks muutmisega hätta. Anti välja veateade tüübist System.FormatException koos selgitusega, et etteantud sõna pole sobival kujul. /* C:Projectsomanaited>Erind1 Unhandled Exception: System.FormatException: Input string was not in a correct format. at System.Number.StringToNumber(String str, NumberStyles options, NumberBuffer& number, NumberFormatInfo info, Boolean parseDecimal) at System.Number.ParseInt32(String s, NumberStyles style, NumberFormatInfo info) at Erind1.Main(String[] arg) */ Vähemasti saime teada, mis juhtus, aga kasutaja ei pruugi sellise teatega kuigivõrd rahul olla. Eriti kui tuleb ette süsteemne veateateaken, mis püüab andmeid kuhugi saata või programmi
I. Portugal ABOUT Photo Location of Portugal (dark green) Portugal (Portuguese: Portugal, IPA: [putua]; officially the Portuguese Republic, Portuguese: República Portuguesa) is a country located in Southwestern Europe, on the Iberian Peninsula. It is the westernmost country of mainland Europe, and is bordered by the Atlantic Ocean to the west and south and by Spain to the north and east. The Atlantic archipelagos of the Azores and Madeira are Portuguese territory as well. The country is named after its second largest city, Porto, whose Latin name wa...
Lühiajalist mälu saab suurendada informatsiooni üldistamisega suuremateks ühikuteks. (Näiteks numbrite puhul jagada suured numbrid gruppidesse. Sõnu jätta meelde luues kategooriaid.) Kompleksse informatsiooni jaotamisega osadeks (Näiteks keerulisemate töö- ja õppeülesannete jaotamisega osaülesanneteks: MS Office’i arvutiprogrammi käskude nägemine tööriistarea kategooriatena (File, Edit, Insert, Format, Tools etc.) ja sealt edasi rippmenüüde sisuna.) Automatismide kujundamisega (Töötava mälu koormuse vähendamisele aitavad kaasa ka akadeemiliste baasoskuste – lugemise, arvutamise, oma tegevuse jälgimise jms treenimine automaatsuseni.) Info paralleelse (visuaalse ja verbaalse) töötlemisvõimaluste pakkumisega. 12. Millise psühholoogilise kontseptsiooni valguses seletas mälu toimimist H. Ebbinghaus? H
Hewlett Packard LaserJet 3310 Copier Hon 4070 Series Pagoda™ Round Back Stacking Chairs Wirebound Voice Message Log Book Newell 336 270c Keytronic 105-Key Spanish Keyboard Universal Premium White Copier/Laser Paper (20Lb. and 87 Bright) Barrel Sharpener Xerox 1924 Eldon Expressions Punched Metal & Wood Desk Accessories, Pewter & Cherry Boston Model 1800 Electric Pencil Sharpener, Gray Large Capacity Hanging Post Binders Durable Pressboard Binders Okidata Pacemark 4410N Wide Format Dot Matrix Printer Bush Advantage Collection® Round Conference Table Col-Erase® Pencils with Erasers Imation 3.5" DS/HD IBM Formatted Diskettes, 10/Pack White Dual Perf Computer Printout Paper, 2700 Sheets, 1 Part, Heavyweight, 20 Office Star - Task Chair with Contemporary Loop Arms Acco Perma® 3000 Stacking Storage Drawers Bush Westfield Collection Bookcases, Dark Cherry Finish, Fully Assembled Xerox 1923 Iceberg Mobile Mega Data/Printer Cart ®
Viljo Viljasoo, Triinu Nõu, Mariko Pedaja ÜLIÕPILASTÖÖDE KOOSTAMISE JA VORMISTAMISE JUHEND The Guide for Composing and Presentation of Undergraduate Works Tartu 2008 ABSTRACT Viljo Viljasoo, Triinu Nõu, Mariko Pedaja. The Guide for Composing and Presentation of Undergraduate Works. Tartu, 2008. Methodology Guide. 29 pages, with Appendices 51 pages, 4 figures. Format A4. In Estonian language. UNDERGRADUATE WORK, DRAWING UP, GUIDE, PRESENTATION The Guide deals with the presentation requirements of undergraduate's technical research papers and bachelor papers. Separate chapters are about the presentation of tables and drawings, general structure and ordering of the report and contents. There are also some guidelines concerning equations and bibliographic references. Some examples are included.
Biti seisund seatakse järgnevalt: The device driver software receives a frame of IP, IPX, NetBIOS, or other higher-layer protocol data. From this data, the device driver constructs a frame, with appropriate Ethernet header information and a frame check sequence at the end. The circuitry on the adapter card then takes the frame and converts it into an electrical signal. The voltage transitions in the transmitted bit stream are in accordance to the format called Manchester Signal Encoding. Manchester encoding describes how a binary ONE and ZERO are to be represented electrically. Manchester encoding is used in all 10 Megabit per second Ethernets; for example, 10BASE2 Thin Ethernet, 10BASE5 Thick Ethernet, and 10BASE-T Twisted-Pair Ethernet. You may want to read the additional perspective on Manchester encoding. In the 100 Mbps Ethernet section of the Compendium there is a section describing the different Fast Ethernet encoding schemes.
JAHU Eesti turul on väga palju erinevatest maadest imporditud jahu. Eestis kasvatatud nisu ning sellest jahvatatud jahu ei jää oma küpsetusomaduste poolest mitte millegi poolest alla Läänest sisseveetud jahule. Tänu väetiste ohtrale kasutamisele Euroopas saadakse suuri hektarisaake, kuid tugevasti saab kannatada jahu kleepvalgu kvaliteet, st. et kleepvalk ei ole enam elastse närimiskummi konsistentsiga, vaid muutub vedelaks, mille tõttu taigna kuju ei püsi. Optimaalne kleepvalgu sisaldus on 28-30%, kui see on alla 25%, siis korralikku saia ei saa. Tuhasisaldus näitab jahu heledust KLEEPVALGU SISALDUSE JÄRGI: TUHASISALDUSE JÄRGI: Tähis min.% max.% Tähis min% max% A 33 - 405 - 0,50 B 31 32 550 0,51 0,63 C 28 30 ...
JAHU Eesti turul on väga palju erinevatest maadest imporditud jahu. Eestis kasvatatud nisu ning sellest jahvatatud jahu ei jää oma küpsetusomaduste poolest mitte millegi poolest alla Läänest sisseveetud jahule. Tänu väetiste ohtrale kasutamisele Euroopas saadakse suuri hektarisaake, kuid tugevasti saab kannatada jahu kleepvalgu kvaliteet, st. et kleepvalk ei ole enam elastse närimiskummi konsistentsiga, vaid muutub vedelaks, mille tõttu taigna kuju ei püsi. Optimaalne kleepvalgu sisaldus on 28-30%, kui see on alla 25%, siis korralikku saia ei saa. Tuhasisaldus näitab jahu heledust KLEEPVALGU SISALDUSE JÄRGI: TUHASISALDUSE JÄRGI: Tähis min.% max.% Tähis min% max% A 33 - 405 - 0,50 B 31 32 550 0,51 0,63 C 28 30 ...
consist of many sub-principles: 1. Customer focus 2. Culture and people 3. Workplace standardization 4. Elimination of waste 5. Continuous improvement and built-in quality It is a result of extensive studies of lean production and construction principles. CII also summarized many sub-principles for each top level principle and structured it into a simple tool called "The Lean Wheel". Its idea is to simplify and organize lean principles into a format that it is easily understandable by everybody. Figure 3.9 The Lean Wheel for a simple presentation of Lean principles, source CII 2005 43 3.3.3 Management theory in construction Production management is divided into two main theories: production theory and management theory. Koskela (2000) suggested that there are three different views to production, each providing principles
Haapsalu Kutsehariduskeskus Arvutigraafika Adobe Photoshop CS6 baasil Mario Metshein Sisukord Sisukord.......................................................................................................1 02 - Photoshop - Mis on arvutigraafika.........................................................4 03 - Photoshop - Tere Photoshop..................................................................9 04 - Photoshop - Esimene pilditöötlus (Ülesanne 1)...................................24 05 - Photoshop - Mittelõhkuv pilditöötlus (Ülesanne 2)..............................41 Ülesanne 2.................................................................................................61 06 - Photoshop - Pildiparandused (Ülesanne 3)..........................................63 Ülesanne 3.................................................................................................69 07 - Photoshop - Kihiline pilditöötlus (Ülesanne 4)..........
easy to back up and replicate, easy to move, and easy to delete. There is no hardware integration (the only dependency is a formatted LUN that the host can access), so this simplifies ownership of virtual hard disks. None of these benefits apply to raw LUNs, known as pass-through disks in Hyper-V. The subject of virtual hard disks (types, formats, and management) will be covered in much more detail when you look at configuring virtual machines. WServer still supports VHD format, but now offers a faster and more scalable format called VHDX. Why Booting from IDe Doesn’t Cause a problem Those who are unfamiliar with Hyper-V might be shocked to see that Hyper-V virtual machines boot from a virtual IDE controller. This has nothing to do with hardware and does not require a physical IDE controller. The virtual device does not have a performance impact. The great debate: where to store virtual machine files
Eksam: Teooriaküsimused + kaasus (sarnane sellele, mis seminaris läbivõetud ja kodutööna lahendatud) 1. ÜHINGUÕIGUSE PÕHIMÕISTED 1.1. Ühinguõiguse mõiste ja koht õigussüsteemis Kuulub eraõiguse alla; üks kandvamaid osasid TsÜSi kõrval. Ühigus ei puuduta ainul ühinguid vaid ka laiemalt kõiki muid äritegevusega seotuid füüsilisi ja juriidilisi isikuid (sihtasutus, füüsilisest isikust ettevõtja, filial jne.) 1.1.1. Ühinguõiguse mõiste Ühinguõigus (objektiivses tähenduses)- õigusnormide kogum, mis reguleerib ühingutega seonduvat (nii juriidilised isikud kui ka mittejuriidilised isikud), st peamiselt liigid, õiguslik seisund, asutamine ja lõpetamine, ümberkorraldamine, sise- ja välissuhted, esindus ja vastustus. Ühingu mõiste: a) lai tähendus- kõik eraõiguslikud ühendused, va asutused. b) kitsas tähendus- korporatiivse struktuurita eraõiguslikud ühingud, eelkõige isikuteühingud (nt seltsing, ...
sum of products, and can therefore be created by a sufficiently large PAL. A PAL is programmed by fitting it into a machine called a PAL programmer. PAL programmers are usually general-purpose machines that can program all types of PLD from all manufacturers. A PAL may be programmed only once. The PAL programmer must be supplied with a description of the PAL's desired configuration. This is usually in the form of a computer text file with a standard format defined by the Joint Electron Device Engineering Council (JEDEC). JEDEC files can be hand-typed by the design engineer or, more commonly, produced by a computer program similar to the language compilers used by software engineers. kasutaja poolt programmeeritavad maatriks-struktuurid (FPGA - Field Programmable Gate Array) A field-programmable gate array or FPGA is a gate array that can reprogrammed after it is
200,300 vedelgaas oon- katlad 35000- 55000 põleti töötavad kütuse ülemisel kütteväärtus el Maagaas Format, võib Hästi Biterm, Sime, Gaasikatlad kasutada ka 12000 50000 automatiseeritav Etta, Arimax, (malm, teras) kerget 9096,5 %* (kallimad Võimalik NGP, Xilo,
sum of products, and can therefore be created by a sufficiently large PAL. A PAL is programmed by fitting it into a machine called a PAL programmer. PAL programmers are usually general-purpose machines that can program all types of PLD from all manufacturers. A PAL may be programmed only once. The PAL programmer must be supplied with a description of the PAL's desired configuration. This is usually in the form of a computer text file with a standard format defined by the Joint Electron Device Engineering Council (JEDEC). JEDEC files can be hand-typed by the design engineer or, more commonly, produced by a computer program similar to the language compilers used by software engineers. kasutaja poolt programmeeritavad maatriks-struktuurid (FPGA - Field Programmable Gate Array) A field-programmable gate array or FPGA is a gate array that can reprogrammed after it is
PSYCHOLOGY PART 1: CORE Biological level of analysis Outline principles that define the biological level of analysis. 1) Behavior can be innate, because it is genetically based. Evolution may play a key role in behavior. 2) Animals may be studied as a means of understanding human behavior. 3) There are biological correlates of behavior. Cognitions, emotions and behaviors are products of the anatomy and physiology of our nervous and endocrine system. Explain how principles of the biological level of analysis may be demonstrated in research. 1) Correlational studies: Study by Buss, who hypothesized that across cultures, men will prefer to marry younger women because of greater reproductive capacity and women will place greater value on a potential mate's earning potential to provide survival advantages. This evolutionary hypothesis was tested in 37 cultures by sending out questione...