criminals. But surely, you can see what you're getting in the holiday brochure. But surely, if you raise benefits too high, people wouldn't bother to work. But surely, the canal system is much too slow for industry today 7.2 Countering politely (through agreement followed by antithesis) Well yes, but if you visit it in June, it's extremely beautiful. Yes, but a serious astrologer would want to know a person's exact date of birth, not just their star sign. Yes, but remember that prisons are often schools for criminals. Yes, but we measure our superiority in different ways. Ours is cultural and historical. We believe we're more civilized. Yes, but it isn't that women don't want to work. For a start, they suffer more discrimination in the work-place. Yes, but other things happen in the world which aren't violent. 7
To: Tallinn Tourism Office From: Edgar Rootalu Date: 05.12.2008 Subject: Tourist capabilities in Tallinn Tallinn is a very good city for tourism. It has populatin of 403 547 people to be exact, so its not very crowded and not a hamlet too. There's plenty to do in this historic city. Tallinn really has a long history of its names and flag. There have been many rulers with different nationalities, so there are marks of their architecture too. There are very many positive things connected with that city: · Tallinn has a very special old town that you cannot find in any other countries. It has middle age architecture combined with little modern one. · Kadriorg palace ensemble is beautiful place, especially in Spirng when teh nature is ,,waking up". · Tallinn also has big shopping centres where you can take a cup of good quality coffee in some nice cafes. · Local people are quite helpful, so you can a...
studies. Such schools may be really named the schools of life because children studying there are forced to grow up earlier than others. Furthermore, present youngsters spend a great deal of their spare time sitting in Internet. They communicate, study and play games in simulated environment of the virtual world. That is the place where young people really get the most information. Internet has the only advantage comparing with schools, information from there never becomes out of date. Thus, we may affirm that youngsters don`t get enough information at ordinary school to face the world tomorrow. They get from there the base, the most information they can need. Then everything is up to themselves.
Võsa 7 Vasalemma 76101 Estonia John Black & Co 49 Crown Road Ambridge 10 March 2010 Dear Sir/Madam I am writing to apply for the position of Office Junior, which was advertised in Eesti Ekspress on 1 March 2010. I am currently employed as Junior Administration Officer in X-Global Services, where I am responsible for processing of orders and preparing bills. My duties also include answering to phone calls and e-mails. I graduated from the secondary school in 2007 and passed a course in office administration in 2008. I am fluent in Estonian and English. I believe I would be suitable...
Dear Alice, Date: I received your nice letter and I understood that you're interested in healthy lifstyle. If you want to start, I suggest to start checking what you eat. You should eat a lot of fruits, fresh vegetables and "green stuff", because fresh food contains most of the necessary vitamins. I don't forbid you from anything, but I think you should avoid fries, hamburgers, potato chips and sweets. Did you know, that it is important to eat everything you like, but in the right
To: The Crime Prevention Officer From: - Date: 28 October 2010 Subject: Increase in crimes Introduction The purpose of this report is to suggest reasons why criminals target the area and give some advice on how to make buildings more crime-proof. 1 Inveiglement Firstly, people keep their valuable items in the visible places like on the window sill and that entices the criminals. Recommendation: Valuable items should be put away, where it is impossible to see them from the window. 2 Security systems Another thing to mention is that people do not give much attention to the security of their houses. That decreases dread of being caught and criminals are getting more and more impudent. Recommendation: Security systems and security cameras should be installed in the buildings. That increases the chance that the criminals will be caught or they dare not to commit the crime. 3 Dogs Finally, burglars can easily hide themselves behind the ...
portion of women and children were killed. · Dozens of villages, schools and public buildings were burned to the ground. German Occupation · Most Estonians greeted the Germans with relatively open arms. · In April 1941, Alfred Rosenberg laid out his plans for the East. · Rosenberg felt that Estonians were the most Germanic out of the people living by the Baltic Sea. The Holocaust · The first records of some jews in Estonia date back to the 14th century. · The creation of the Republic of Estonia marked the beginning of a new era for Jews. · Nazi government's intention was to use the Baltic countries as their main area of mass genocide. · Approximately 10,000 jews were killed in Estonia. Attempt to restore independence · As the german's retreated on September 18, Jüri Uluots formed a government led by Otto Tief. · The Nazi flag on Pikk Hermann was replaced
To: Tom Allen, the editor of the newspaper From: Ray Iverson, journalist Subject: The good and bad points of the Bayside Sports Centre Date: 23 January 2015 Introduction: The idea of this report is to describe the situation at the Bayside sports center and making recommendations for improvement. Positive aspects: Firstly, there is wide range of activities available, also there are new and modern equipment in the Bayside sports center. Secondly, the sports center is opened seven days a week. Thirdly, there are working well trained instructors and sufficient staff, which is really good. Negative aspects: There are some bad aspects too in the sports center. Firstly, there are not enough exercise machines, so you have to wait for a long time to use them. Secondly, prices are high and there are no special offers. Thirdly, the staff is not very friendly and it takes a long time to get their help. Recommendations: There should be some change...
To: local authorities From: a member of the Nature Club Subject: environmental situation at Poku Date: 19 November 2010 Introduction As a member of the Nature Club I have decided to write a report on the environmental situation at Poku and make recommendations based on the opinion poll carried out at Poku. The results of the opinion poll are presented below. Pollution General situation at Poku is satisfactory as the level of water and noise pollution is rather low as there are no big industrial enterprises in the vicinity. Problematic areas are air and litter pollution as many tourists visit the place leaving behind exhaust gases and rubbish on the ground. Wildlife In the forests near Poku there is comparatively rich in wildlife. The only problem seems to be cutting trees which may leave the local animals without their usual habitat. Recycling Recycling of paper and glass is very well organised in the area of Poku. More problema...
To: Walter White, Manager From: Rick Grimes Subject: Suggested improvements to make the shop more profitable Date: 3rd December 2012 Purpose: The purpose of this report is to make recommendations on how to improve the shop and make it more profitable. Discounts: Firstly, one suggestion would be to make several discounts on popural products. For example, reducing the price of a popural item by about 15 percent would really pay off. Also if a customer buys two same items, he gets the third one for free. This would certainly be profitable and I am confident that more people would visit your shop. Extra shop assistants: Lastly, I think that hiring an extra two or three shop assistants would be a very good idea too. Then customers would have to wait less to pay for their items and the shop could service a lot more customers than before. Bonuses for regular customers: Secondly, I think that regular customers who have been visting your shop f...
Report To: The headmistress of the school From: Max Hoffmann Subject: Nõmme adventure park Date: 21th March 2014 Introduction The aim of this report is to assess a newly established Nõmme adventure park and to see if it is suitable to use for field trips. Park overview Nõmme adventure is located in Tallinn, the capital of Estonia. Park was established in June 2013. It is a park up in the trees. Venturing the trails up in the trees gives you an opportunity to discover yourself and company in exhilarating situations. This very park had totally 6 trails. With each trail new hight is reached and more difficult obstacles are passed through. Finances Even though, the prices are high, it is worth it, as unfoegettable experience will be received. Adults pay 17 per day, youth pay 13 per day. Luckily, there is a chance to get a discount for groups up to 10 students. Facilities For foreign groups there ...
to: Mr,Watson from:Kerli Lehiste subject: A shopping centre ''Lõunakeskus'' in Tartu. Date: 29.11.2010 Introduction: The aim of this report is to describe a shopping centre''Lõunakeskus''in Tartu and asses its good and bad points. Location: A shopping centre ''Lõunakeskus'' is located in the main city.However, it is far from the central train and bus stations.There are a lot of parking. Yet, the car park is often crowded. Facilities: There are more than 16 diffrent shops and services.There are many men, woman´s, children´s, decorative´s, shoes shops..''Lõunakeskus'' has been rated leisure place for whole family. Here is full- size year-round working rink, AHHAA 4Dcinema experience, campus traffic elektric cars for children, sportclub.However in those services are no surveillance for children. Parents must do too all those attractions and children must later shop with parents.It could be easiler when there are surveillance for kids.Then ...
AK-47 Place and date Russia, 1944-1946 Weight 4.3 kg (9.5 lb) with empty magazine Length 870 mm (34.3 in) fixed wooden stock Overall Barrel length Cartridge 415 mm (16.3 in) 7.62x39mm M43 Action Gas- information operated, rotating bolt Rate of fire 600 rounds/min Muzzle velocity 715 m/s (2,346 ft/s) Effective range 100800 sight adjustments m Feed system 30-round detachable box magazine, also compatible with 40- round box or 75- ...
Australian symbols National symbols of Australia are the symbols that are used to represent what is unique about the nation, reflecting different aspects of its cultural life and history. FLAG- It was first flown in Melbourne on 3 September 1901. This date has been proclaimed as Australian National Flag Day. COAT OF ARMS- The Coat of Arms is the formal symbol of Australia and its ownership and authority. ANTHEM- Created by the Scottish-born composer Peter Dodds McCormick, the song was first performed in 1878, and was sung in Australia as a patriotic song. It did not gain its status as the official anthem until 1984, following a plebiscite to choose the national anthem in 1977.
Kuupäeva ja kellaaja funktsioonid 1)TODAY()- annab tänase kuupäeva 2)YEAR(kuupäev)- annab aastaarvu 3)MONTH(kuupäev)- annab kuu järjekorranumbri 4)DAY(kuupäev)- annab päeva järjekorranumbri 5)DATE(aasta;kuu;päev)- annab kuupäeva 6)WEEKDAY(kuupäev)- annab nädalapäeva järjekorranumbri alates pühapäevast WEEKDAY(kuupäev;2)- annab nädalapäeva järjekorranumbri alates esmaspäevast Tehted kuupäevadega: 1)Kuupäeva teisendatakse seerianumbriteks. Seerianumber on päevade arv 01.01.1900 kuni sisestatu Kuupäev Seerianumber Selleks et saada kuupäevast seerianumber tuleb: 12/31/1899 1 1)Valida kuupäevaga tabelilahter(kursori kuju on valg 9/19/2018 43362 2)Home-Number-Number 12/31/9999 2958465 2)Tehted sooritatakse seerianumbritega 3)Tulemus väljastatakse tavaliselt kuupäeva kujul 9/19/2018 3 9/22/2018...
Exeli funktsioonid jagunevad rühmadesse: 1) Maatemaatilised(Math ja Tig) 2)Kuupäeva- ja kellaaja funktsioonid(Date ja Time) 3) Otsimise ja viitamise funktsioonid(Lookup ja Reference) 4)Loogikafunktsioonid (Logical) 5) Finantsfunktsioonid (Financial) 6)Tekstifunktsioonid(Text) 7)Statistikafunktsioonid (Statistical) Matemaatilised funktsioonid 1)Liitmisfunktsioon SUM(Liidetav1;Liidetav2) 5 SUM(piirkond) - liidab kokku piirkonnas olevad arvud 5 7 9 40 12 3 4 9 18 2)Aritmeetiline keskmine AVERAGE(piirkond) - see on tegelikult statistiliine funktsioon - annab piirkonnas olevate arvude aritmeetilise keskmine 3 9 10 7.333333 3)Ruutjuur arvust SQRT(arv) ...
GGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIVKAAEAAKQAMKPGCTLFFLLCSALTVTTEAHAQTPDTA TTAPYLLAGAPTFDLSISQFREDFNSQNPSLPLNEFRAIDSSPDKANLTRAASKINENLYASTALERGTLKIKSI QMTWLPIQGPEQKAAKAKAQEYMAAVIRTLTPLMTKTQSQKKLQSLLTAGKNKRYYTETEGALRYVVADNGEKGL TFAVEPIKLALSESLEGLNKMTIQQWLFSFKGRIGRRDFWIWIGLWFAGMLVLFSLAGKNLLDIQTAAFCLVCLL WPTAAVTVKRLHDRGRSGAWAFLM VASTUS: Kasutasin programmi Protein-protein BLAST (blastp) Format alignments 500 Sarnased järjestused Database: NCBI Protein Reference Sequences Posted date: Apr 9, 2006 5:23 AM Number of letters in database: 811,773,583 Number of sequences in database: 2,250,671 Lambda K H 0.319 0.133 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2250671 Number of Hits to DB: 127332226 Number of extensions: 4937094 Number of successful extensions: 13884 Number of sequences better than 10: 117 Number of HSP's better than 10 without gapping: 0
I have different books. I read quite a lot lovestories. I was read lovestories at one time very a fat lot. I was read those in spring and summer when I have got love in my heart. In the beginning when I read was very exciting. Because there were intrigues and nervous tension. It was very (HUVitav) In the end I have bothered because right- left is something else. I don`t like read books what I have to read for school. The most was boring for me. When I have given read some books a kind of date. I don`t like it. Isually I don`t not come to an end for book. I have ever read actions but I want it read. Kriminal novels are interesting to me. I have read them not much. The last books what I read was drama Shakespeare ,,Hamlet". I don`t likes specially this books. I don`t like me because it was poetical. Was difficult understand the contents what writer wants to say. For that reason I was forced take content summary in internet. I got
traversed by rivers such as the River Shannon and several large lakes Architecture: Some architectural Position: Ireland has two parts, one or loughs. Ireland is known for its features in Ireland date back or them is the part on UK. The ohter gorgeous landscape, the green hillsides to the prehistoric period, and the rocky coastline. including standing part make up the Republic of Ireland. stones and tombs. The best
Priyanshi Somani is a mental calculator. She was the youngest participant of the Mental Calculation World Cup 2010 and won the overall title. She is the only participant who has done 100% accuracy in Addition, Multiplication and Square Root till date in all four Mental Calculation World Cups. Somani is the winner of "Pogo Amazing Kids Awards 2010" in genius category. Her name is also added in the Limca Book of World Records. Priyanshi Somani was born on 16th november in 1998 in india. She is a daughter of businessman Satyen Somani and Anju Somani. She started learning Mental Maths at the age of 6. She was the youngest participant of the Mental Calculation World Cup 2010 and won the overall combination title in Germany
Püha Birgitta Esitluse koostas: Sissejuhatuseks · Püha Birgitta on... Rootsi kristlik pühak; Birgitiinide ordu asutaja; üks olulisim Rootsi keskaegne kirjanik; kuulus kui imetegija ja vaestele kaasatundja; leskede; Euroopa ja Rootsi kaitsepühak. Elukäik · Birgitta Birgersdotter sündis 1303. aastal Rootsis mõjukasse perekonda. · Nime sai tõenäoliselt iiri pühaku Brigida järgi. · Lapsepõlvega on seotud mitmeid legende: Sündimise ööl olevat kohalik kihelkonnapreester näinud ettekuulutust, et sünnib tüdruk, kelle häält saab kuulda kogu maailm. Birgitta polevat kolmanda eluaastani lausunud ühtegi sõna, kuid seejärel hakanud ootamatult kõnelema täiskasvanulikult. · Juba noorena koges ilmutusi. Elukäik · Abiellus 13-aastaselt Ulf Gudmarssoniga. · Koos abikaasaga käidi palverännakutel. · Pärast Ulfi surma astus kloostrisse j...
To: Clara Philipp From: .................. Subject: Suggested improvements to shop Date: 1st April 2011 Introduction The purpose of this report is to make recommendations for possible improvements in the shop. Advertising To begin with, it would be a good idea to think about buying advertising space on local television stations or radio stations. Moreover, we should distribute flyers around our local community, newspaper inserts or on community bulletin boards. In this way the public knows that our shop exists and we will have larger circle of customers. Online Store Secondly, I believe we can also expand our shop by opening up an online store. Albeit a large number of consumers like to shop locally, there is still many, who also prefer shopping online, especially when they are looking for something in particular or something that is hard to find. As a result, having an online store, will increase shop chances of making profit. Versati...
Write a report (on a separate sheet of paper) to the Ministry of Education on the sporting facilities in your school. Write about the places, rooms and equipment and PE lessons (number of lessons a week, teachers, trainings) and if anything should be improved. Rules - in notebook, See alsoTB p 202. Write ab. 200 words. To: Ministry of Education From: Mari Mets, student of Mets Gymnasium Subject: The sporting facilities in our school Date: 2 February 2016 Introduction The purpose of this report is to give an overview of sporting facilities in our school and give some recommendations to improve it. My findings are presented below. Places and rooms Teachers would like us to be outside as much as possible, so majority of lessons take place outdoors. Students can have their lessons free at Tehvandi Sports Centre. In case of a bad weather we usually do our lessons in big and modern sports hall. Equipment Students can use different balls and...
answers and asked him not to reveal the questions to others, since they were planning to ask the same questions. When he went out naturally others were curious to know what was asked. He politely declined, but one persistent Santa would not leave him. "At least tell me the answers" he pleaded, and our friend obliged. Then it was the turn of this Santa. When he went inside, since his resume was slightly illegible, the board member asked him." By the way, what is your date of birth?" He replied, " The effort began a few years earlier and final result was in 1947." Somewhat puzzled, they asked another clarification. "What is your fathers name?" He replied, "There were so many. Whom to mention". If I name one, it will be injustice to another". The interviewer was incensed. " Hey! Are you mad or what?" He replied. "Some research is going on the subject. I can answer with certainty only after seeing the report." *************
Two minutes' silence is held at 11 a.m., which represents the 11th hour of the 11th day of the 11th month in 1918 Local ceremonies in the UK Significant ceremonies also take place across the regions of the United Kingdom Most notably in Edinburgh Castle, in Cardiff and in the grounds of the Belfast City Hall Armistiche Day Armistice Day, also known as Remembrance Day, is on 11 November and commemorates the armistice signed between the Allies of World War I and Germany The date was declared a national holiday in many allied nations, to commemorate those who were killed during war Armistice Day From 1919 until 1945, Armistice Day observance was always on 11 November itself It was then moved to Remembrance Sunday, but since 1995, it has become usual to hold ceremonies on both Armistice Day and Remembrance Sunday History The armistice between the Allies and Germany was an agreement that ended the fighting in the First World War
Subject: Proposal concerning the new shopping center Date: November 11, 2013 Introduction The purpose of this proposal is to give insight into the residents' committee's opinions regarding the new shopping center. Reasons it should be built The resident's committee has concluded that the new shopping center would be useful for people in our town as it would give them more choice in where to shop. Also, since there are no any decent sized shopping centers nor malls nearby, the new one would make people's lives easier since they would not have to drive as far out of the town as they are used to at the moment. Stores the shopping center should contain The shopping center should most importantly contain a big grocery store where people could buy their everyday food and drinks. Clothing stores would also be very useful as there are not many around this town. Lastly, we would propose electronics and free time stores and sporting goods store...
4. Lõigetes 1 ja 3 nimetatud väljaõpe ei või toimuda töötajate või nende esindajate kulul. Lõikes 1 nimetatud väljaõpe peab toimuma tööajal. Lõikes 3 nimetatud väljaõpe peab toimuma tööajal ja kooskõlas siseriiklike tavadega kas ettevõttes ja/või asutuses või väljaspool seda. Eesti õigusakt: Töötervishoiu ja tööohutuse nõuded ehituses Legal act: Vabariigi Valitsuse määrus; Official Journal: Elektrooniline Riigi Teataja, Publication date: 01/06/2002; Reference: (MNE(2003)54752) Tegevusaladele esitatavad töötervishoiu ja tööohutuse nõuded Legal act: Vabariigi Valitsuse määrus; Official Journal: Elektrooniline Riigi Teataja, Publication date: 01/06/2002; Reference: (MNE(2003)54545) Töövahendi kasutamise töötervishoiu ja tööohutuse nõuded Legal act: Vabariigi Valitsuse määrus; Official Journal: Elektrooniline Riigi Teataja, Publication date: 29/12/2003; Reference: (MNE(2003)55377)
Hours later, signs of remembrance began to appear all over the world. A wreath of white flowers stood next to her star on the Hollywood Walk of Fame, and a marquee outside the Hollywood Bowl theater read, "Ella, we will miss you." Birth Name: Ella Fitzgerald Nickname: "Lady Ella" and "First Lady of Song" Birth date: April 25, 1917 Birth place: Newport News, Va. Death date: June 15, 1996 Death place: Beverly Hills, Calif. Parents: William Fitzgerald, Temperance Siblings: Frances Da Silva (half sister) Married: Benny Kornegay (19391940), Ray Brown (19461952)
sumif SUMIF(A4:A8;2) 4 ruutjuur pii (3,14) numbri teisendab roomanumbriks astendamine ümardab määratud lahtri etteantud komakohani logaritm Liidab määratud arvud Liidab arvud 2 kogused Kuupäevafunktsioonid Tänane kuupäev või kellaaeg oleneb 27.04.1998 now NOW() 5:23:20 AM Date või Time 25.11.2012 year YEAR(A3) 1998 Valib etteantud kuupäevast aasta month MONTH(A3) 4 Valib etteantud kuupäevast kuu day DAY(A3) 27 Valib etteantud kuupäevast päeva today TODAY() 25.11.2012 Praegune kuupäev Leiab kuupäevade vahe päevades (nä
Learning 6. Current 7. Unforeseen 8. B 9. A 10. flooding/being flooded C DATE DIRECTION Ex1. 1. Fix 2. Confirm 3. Brought forward 4. Ex1. 1. Looking in 2. Ask for 3. Take 4. Gave 5. Delayed 5. Change 6. Make Changed 6. Heading in Ex2. 1. Earilest possible 2. Expiry 3. Later 4. Ex2. 1. Right 2. Clear 3. Opposite 4. Clockwise 5. Completion 5. Closing 6. Sell- by date 7. Firm 8. Westerly 6. Same 7. General 8. Wrong Particular Ex3. 1. Every 2. Each 3. All 4. One 5. Both Ex3. 1. Birth 2. General election 3. Wedding 4. Applications 5. Meeting 6. Manufacture DISASTER DAY Ex1. 1. Struck 2. Averted 3. Heading for 4. Spelt Ex1. 1. Other 2. Some/ one 3. These 4. A, one 5. 5. Courting 6. Ended in Any 6. All 7. Very 8
Eesti popmuusika 1920.1960.dad 1) Missugune sündmus tähistab Eest popjazzmuusika algust? The Murphy Band'i loomine Tallinnas 2) Millal ja kus toimus esimene Eest jazz kontsert? 1936. aastal, Estonia konsterdisaalis 3) Nimeta 30date aastate lööklaulude autoreid Boris Kõrver; Raimond Valgre 4) Nimeta 50date aastate tuntumaid ansambleid ja liikmeid Rütmikud Arne Oit; Uno Naisso; Valter Ojakäär; Gennadi Podelski; Vallo Järvi Metronoom Uno Naisso; Heli Lääts; Kalmer Tennosaar 5) Missugune instrument oli Külma sõja ajal keelatud? Saksofon 6) Kes oli Eesti Swing Clubi asutaja? Uno Naissoo 7) Kes esindasid Eestit 1957.aastal Moskvas Noorsoofestivalil? Uno Naissoo; Heli Lääts; Kalmer Tennosaar 8) Kuidas on Eesti popmuusika ajalukku läinud V. Järvi & E. Laansoo? V.Järvi hakkas esimesena kasutama võimendatud instrumenti E.Laansoo katsetas mitmekordset pealemängu, mis parandas oluliselt helikvaliteeti. 9) Iseloomusta 1960.te jazzi ja nimeta m...
Yes, you guest rightly, the city what about I am talking is Barcelona in Spain. It is a wonderful city. Firstly, there is quit worm, even then when in North European is cold, in summer is the weather even hotter but it the best thing about Barcelona. The secondly Barcelona is located beside the Mediterranean Sea. Water in there is green colour and it is beautiful to look. Architecture in Barcelona is stunning all of the buildings are originals. Many of the buildings date from medieval times, some from as far back as the Roman settlement of Barcelona. The biggest building Barcelona is definitely The Temple Expiatori de la Sagrada Família, often simply called Sagrada Familia is a massive Roman Catholic Church. It has been under construction since 1882, and is still financed by private donations. As of 2007, completion is planned for 2026. These were my favourites' things when I visited Barcelona but these were not only
Francophonie. Population: 33,437,000 Area total: 9,984,670 km² Currency: Dollar Government: Parliamentary democracy and Constitutional monarchy - Monarch: Queen Elizabeth II - Governor General: Michaëlle Jean - Prime Minister: Stephen Harper Flag of Canada The National Flag of Canada, also known as the Maple Leaf The flag made its first appearance on February 15, 1965; the date is now celebrated annually as National Flag of Canada Day Torontos CN Tower Height 553.33 m Completed in 1976 Visitors per year 2 million Weight 130,000 tons Communication mast 400,000 bolts Cost $ 57 million Wind tolerance more than 300 km/h Lightning strikes per year 75 The Niagara Falls
Dear Neander Taal, Once again, I find disappointment. Once again, I find no satisfaction. Once again, I find that my motivations for writing this letter are not of insult or hatred, but of the deepest love for mankind and the truest concern for its future generations. It is requisite, even in this summary sketch, to go back a few years to see how I admit I have a tendency to become a bit insensitive whenever I rebuke Laivi Tuvahe for trying to leach integrity and honor from our souls. While I am desirous of mending this tiny personality flaw, by brainwashing her apologists with anarchism, Laivi makes them easy to lead, easy to program, and easy to enslave. I would like to comment on Laivi's attempt to associate hooliganism with Dadaism. There is no association. Should we be concerned that Laivi wants to destroy that which is the envy of--and model for--the entire civilized world? I'll answer that question for you: Yes, we shoul...
Report To: From: Subject: School Brochure Date: 5.12.2010 Purpose The purpose of this report is to make reccmmendations regarding which aspects of life at the school should be represented in the brochure and which photographs should be used. Short History of the School In the brochure, there should be a section for the school history to show people how long this school has been working and how successful it has been over the years. Secondly, why there should be a part fot history is for people to understand the school's motto and ethics better. Other Schools in the Area In my opinion, other schools in the area should also be noted because it shows the good location of this school. Having other good and wealthy schools in the area, gives us the possibility to show us from the same side. School Activities In addition to these, we should mention the different activities that we have in our school. We should mention activities such as ...
Klassikaline sõidustiil Klassikaline sõidustiil oli murdmasuusatamise puhul ainsaks stiiliks kuni 1980 -date aastateni. Klassikalise sõidustiili puhul eristatakse diagonaal- või vahelduvsammu, käär- või mäkketõususammu (vahelduvtõukeline sõiduviis), paaristõukeid ja vahesammuga paaristõukeid (paaristõukeline sõiduviis). Klassikaline sõidustiil sobib sõitmiseks paksus lumes ja ettetehtud raja puhul. Klassikalise sammu sõitmise puhul määritakse suusa keskosale pidamismääret ja muule osale libisemismääret. Suusakepid on klassikalise sammu sõitmisel lühemad kui uisusammu sõitmise puhul. Suusasaapad on madalad ja lubavad kanna-pöialiigesel liikuda. Paaristõukeline sammuta sõiduviis Paaristõukelist sammuta sõiduviisi kasutatakse, kui suuskade liugekiirus või pidamistingimused ei võimalda resultatiivselt suusaga tõugata. Sõiduviisi eesmärk on saavutada suuskade liugekiirus, mis vastab suusataja kehalisele seisundile ja taktikalisele kaalutlus...
Sports Centre Jyri sport centre is a modern building with up to date technology. The sports centre includes a gym, budo hall, dance hall, swimming pool and a room where you can play pall games. I think Jyri sports centre has more advantages than disadvantages. I am rather optimistic and think it is such a privilege that we have sports centre in jyri. Thanks to the sports centre there is many hobbies you can choose from. You can learn different martial arts, different dances, basketball, football and table tennis. you can take swimming lessons and
What`s your job? HOTEL RECEPTIONIST Hotel receptionists are responsible for making guests feel welcome, dealing with room bookings and cancellation, and handling general requests made by guests during their stay. You would spend most of your time behind a reception desk, using a computer and telephone switchboard. You would usually work shifts, which could include evenings, nights, weekends and public holidays. Part-time and seasonal work often available. DUTIES AND RESPONSIBILITIES: · Dealing with reservations by phone, e-mail, letter, fax or face-to-face. · Checking guests info and of the hotel, allocating rooms and handing out keys. · Preparing bills and taking payments. · Answering questions about the hotel and the surrounding area. · Dealing with complaints or problems. In larger hotels, you would use a computerised system to make reservations and keep room bookings and availability...
To: Ms Head teacher From: Iti Tomingas-Oras Subject: Helping the environment Date: 6th September Introduction The Pupose of this report is to present my findings about heping the enviroment in our school. I have carried out a survey among the students at Kose Gymnasium. My findings are presented below. Findings The first thing students thought was that our school is using and wasting paper. Theatchers do not use both sides of paper while printing. Secondly the students have noticed that the computers are not always turned off at end of the day. They take a lot of power and waste energy if they are turned on overnight. The tird thing I found out is that our school does not recycle and reuse enouhg which is also bad influence for the environment. Reccomendations Firstly, I would like to suggest to reduce paper. For example send more emails or if the printing is really nessesary use both sided of the paper. Secondly I reccomend tuni...
flowed backward for 1024 hours to fill the lake. Lookout mountain & Signal Point Interesting Facts. · There lives about 6,403,353 people in Tennessee. · Tennessee has played a critical role in the development of rock and roll and early blues music. · Tennessee's highest point : Clingmans Dome 6,643ft (2025 m) · Tennessee is home to the most caves in the United States, with over 8,350 caves registered to date. · Tennessee was admitted to the Union as the 16th state on June 1, 1796. · Tennessee is about 109,247 km2 big · Memphis was also home to Sun Records, where musicians such as Elvis Presley, Johnny Cash, Carl Perkins, Jerry Lee Lewis, Roy Orbison, and Charlie Rich began their recording careers, and where rock and roll took shape in the 1950s. State seal of Tennessee Flag of Tennessee
Japanese festivals Japanese festivals are traditional festive occasions. Some festivals have their roots in Chinese festivals but have undergone dramatic changes as they mixed with local customs. Some are so different that they do not even remotely resemble the original festival despite sharing the same name and date. There are also various local festivals (e.g. Tobata Gion) that are mostly unknown outside a given prefecture. It is commonly said that you will always find a festival somewhere in Japan. Matsuri is the Japanese word for a festival or holiday. In Japan, festivals are usually sponsored by a local shrine or temple, though they can be secular. There is no specific matsuri days for all of Japan; dates vary from area to area, and even
Mart day 10. november How mart day is get it name? Mardi day is on 10. november. That date is Mardi day get from the Martin Luther, who birthday is on 10 november 1483 year. How it celebrate in erst? On that day the autumn farming was end. Live stock impeled in the shed. In the Mart day people ate the goose, cooked sausages, drunk bear. That day solemnize soles came home and end the soul period. On that day were some work interdict because didn't may interfere the souls, prime- the womenkind works and make noise. After that day started to do inside works started wintertime.
ROWAN ATKINSON Date of Birth: January 6, 1955 The man with a rubber face, who can change his appearance from total buffoon to a snobbish aristocrat in the blink of an eye, was born and raised in Newcastle- upon-Tyne in England. With his farmer father, Atkinson attended a private school with his two older brothers. Following school, he furthered his education at Newcastle University. He then went to Oxford University to complete an electrical engineering degree. The school led him to future screenwriter Richard
VALGUD Kristel Mäekask Valgud ehk proteiinid polüpeptiidid, mis koosnevad aminohappejääkidest Aminohapped koosnevad aminorühmast ja karboksüülrühmast. Valkude koostises on 20 erinevat aminohapet. Valkude süntees toimub ribosoomides. Valkude jaotus Lihtvalgud koosnevad aminohappejääkidest nt munavalge. Liitvalgud koosnevad valgulisest ja mittevalgulisest osast nt kromosoomid (nukleoproteiinid) ja hemoglobiin. Valgustruktuurid primaar-, sekundaar-, tertsiaar-, kvaternaarstruktuur Kõikidel valkudel on primaarstruktuur Selle aminohapete järjestuse järgi on näidatud valkude omadused. Aminohapped on ühendatud peptiidsidemetega. Sekundaarstruktuur - heeliks - struktuur seotud vesiniksidemetega Kõõluste, kõhrede, juuste, ...
Types of holiday: Career in Tourism Trends in tourism Alandatud hind-Discount price Alaline,püsiv-permanent Ajavahe-jet lag Ekstreemturism-Hardship holiday Autasu-Reward Edasi-tagasi pilet-Return ticket Eripakkumine(soodushinnag)-Special rate Avatud inimene-Outgoing personality Jõukas-Affluent Eripakkumine-Special offer Hariduskäik-Educational history Jõukus-Prosperity Hobi-või huvialaturism-Special interest holiday Honorar-Fee Kaasmaalane-Compatriot Järsku alandatud-rock-bottom price Juhi töökoht-Management job Kasum,tulu-Revenue Kallis-expensive Kaaskiri-Covering letter Koopia-...
Andmebaasid. Kirjed (records) Andmebaasi tabeli ridu nimetatakse kirjeteks Kirjetel on järgmised omadused nende arv pole määratud. Neid saab vastavalt vajadusele lisada või eemaldada on ühes tabelis ühesuguse struktuuriga nende tähendus ei olene järjekorrast Väljad(fields) Andmebaasi verge nimetatakse väljadeks. Väljadel on järgnevad omadused: igal väljal on oma nimi, mis määratakse tabeli kirjeldamisel ühes tabelis pole samanimelisi välju andmete tähendus ei sõltu väljade järjekorrast et andmetest teistest väljades. igas väljas on ühesuguse tähendusega elemendid Võti(key) Tabeli primaarvõti(primary key) tagab selle, et tabelis poleks ühesuguseid kirjeid Nõuded võtmele: peab olema unikaalne, sest tabelis ei tohi olla mitut ühe ja sama väärtusega kirjet, s.t et ei tohi olla korduvaid võtme väärtusi võtme väärtus on seotud kirjega. Seda ei muudeta ega ko...
Question Name 1 swimmer who is known in Estonia and 1 who is know in the world About Michael Phelps He has won 28 medals and 23 of them are olympic golds He has a 200 m freestyle world record https://www.youtube.com/watch?v=Era0VAIUATw About swimming history Evidence of recreational swimming in prehistoric times has been found, with the earliest evidence dating to Stone Age paintings from around 10000 years ago. Written references date from 2000 BC, with some of the earliest references to swimming including the Iliad, the Odyssey, the Bible, Beowulf, the Quran and others. In 1538, Nikolaus Wynmann, a German professor of languages, wrote the first swimming book, The Swimmer or A Dialogue on the Art of Swimming About Estonias Most know swimmer Triin Aljand is a women swimmer who ended Talinna Kristiine Gümnaasium and went on with her swimming career In 2012 in Debrecen she swam 50 m butterfly and got
chatting with friends. Talking on the Internet with friends is easy and fast way to communicate. In a chatroomyou can send pictures to your friends or doucments or make a video call. You can also play games and make a group conversation there. But actually it is not full of joy. In chatrooms there are sometimes older men who are trying to contact young girls. I saw a documentary about chatrooms lately and there were men who set up a date with under- aged girl, they recorded it and it was sent to police, because having more-than- friends-relationship with under- aged girl is against the law. Parents and schools should be teaching more about Internet safety nowadays to help kids understand about chatroom dangers. In my opinion second important danger is cheating money from innocent people behind their back. Internet chatrooms gain money by adding any kind of advertisements to their application.
Michael Jordan Made by: Name:Michael Jordan (full name Michael Jeffrey Jordan) Birth date: February 17, 1963 Birth place: Brooklyn, New York, USA As a child, Michael Jordan played baseball, basketball and football. His preferred sport at the time was baseball but after Michael Jordan began spending a lot of time on the basketball court, his outlook changed. Because his older and taller brother, Larry, continuously kept beating him when they played one-on-one, Michael Jordan was determined to become a better play Ironically, in 1978, when Michael Jordan attended
Halloween. A jack-o-lantern is typically a carved pumpkin. It is associated chiefly with the holiday of Halloween. The tradition of carving a lantern started in the British Isles however, it was traditionally carved out of a turnip.They were created on All Hallows' Eve and left on the door step to ward off evil spirits. An offering or, as we now know it, a "treat", would also be commonly left to placate roaming sprites and evil spirit. Halloween's origins date back to the ancient Celtic festival of Samhain. The Celts, who lived 2,000 years ago in the area that is now Ireland, the United Kingdom and northern France, celebrated their new year on November 1. This day marked the end of summer and the harvest and the beginning of the dark, cold winter, a time of year that was often associated with human death. Celts believed that on the night before the new year, the boundary between the worlds of the living and the dead became blurred.
annaabi.ee 
Sisene Facebook'ga
Sisene Google'ga
Sisene LinkedIn'ga
